BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0119 (648 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 25 0.54 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 22 3.8 AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical pro... 22 5.0 U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. 21 6.6 EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 21 6.6 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 21 8.7 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 21 8.7 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 25.0 bits (52), Expect = 0.54 Identities = 20/78 (25%), Positives = 31/78 (39%) Frame = -1 Query: 528 PMAALLVAHASYARTSIVGVKNFLNHCKNSKLSWKRPFTSLSMGTILSTPIFLKPACNIL 349 P L VAHAS + + + CK K + T S+ +L+ I IL Sbjct: 147 PFVELTVAHASVLTILAISFERYYAICKPLKAGYICTKTRASLICLLAWFIAALFTSPIL 206 Query: 348 KFCIYSCSKFVLNLILFI 295 Y ++V I+F+ Sbjct: 207 AITQYGPEEYVDGSIVFV 224 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 22.2 bits (45), Expect = 3.8 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 591 PSSQLXPQTIWESYYNSP 644 PSS TI YYNSP Sbjct: 403 PSSVHSHSTIGNDYYNSP 420 >AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical protein protein. Length = 205 Score = 21.8 bits (44), Expect = 5.0 Identities = 11/32 (34%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = -3 Query: 463 FLEPLQKLKIILET-TLHQFVNGYYLVHTHLF 371 F+ + L I+ + TLH N Y TH+F Sbjct: 44 FIIAIYVLTILTSSVTLHVCFNSYMYAFTHIF 75 >U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. Length = 470 Score = 21.4 bits (43), Expect = 6.6 Identities = 6/17 (35%), Positives = 11/17 (64%) Frame = -1 Query: 279 NSMSMNWQWXHLYTTLR 229 NSM + W ++Y T++ Sbjct: 150 NSMKREYYWPNMYRTIK 166 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 21.4 bits (43), Expect = 6.6 Identities = 13/48 (27%), Positives = 20/48 (41%) Frame = -1 Query: 528 PMAALLVAHASYARTSIVGVKNFLNHCKNSKLSWKRPFTSLSMGTILS 385 P L VAHAS + + + CK K + T S+ +L+ Sbjct: 147 PFVELTVAHASVLTILAISFERYYAICKPLKAGYICTKTRASLICLLA 194 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.0 bits (42), Expect = 8.7 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = -3 Query: 535 PVPHGSPSRRPCVICPH 485 P PH P R P PH Sbjct: 739 PHPHHQPPRNPVGTNPH 755 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 21.0 bits (42), Expect = 8.7 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = -3 Query: 535 PVPHGSPSRRPCVICPH 485 P PH P R P PH Sbjct: 631 PHPHHQPPRNPVGTNPH 647 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 161,345 Number of Sequences: 336 Number of extensions: 3723 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16656800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -