BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0119 (648 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18003| Best HMM Match : No HMM Matches (HMM E-Value=.) 108 4e-24 SB_50092| Best HMM Match : Gal-3-0_sulfotr (HMM E-Value=2.1e-33) 29 2.5 SB_25586| Best HMM Match : RVT_1 (HMM E-Value=2.3e-18) 29 4.3 SB_3270| Best HMM Match : MMPL (HMM E-Value=0.68) 29 4.3 SB_42659| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_19238| Best HMM Match : DUF729 (HMM E-Value=1.4) 27 9.9 SB_2066| Best HMM Match : Dynein_heavy (HMM E-Value=0) 27 9.9 >SB_18003| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 531 Score = 108 bits (259), Expect = 4e-24 Identities = 48/75 (64%), Positives = 56/75 (74%) Frame = +2 Query: 290 VPMKRIKFKTNLEHEYIQNFKILQAGFKKMGVDKIVPIDKLVKGRFQDNFEFLQWFKKFL 469 VP+K++KF EHEYI NFKILQ+ FKK G DKI+P+DKLVKGRFQDNFEFLQWFKKF Sbjct: 43 VPLKKVKFGAKQEHEYIANFKILQSAFKKCGCDKIIPVDKLVKGRFQDNFEFLQWFKKFF 102 Query: 470 TPTMEVRAYDAWATR 514 + Y+A R Sbjct: 103 DANYGGQEYNAVEAR 117 >SB_50092| Best HMM Match : Gal-3-0_sulfotr (HMM E-Value=2.1e-33) Length = 386 Score = 29.5 bits (63), Expect = 2.5 Identities = 25/78 (32%), Positives = 31/78 (39%), Gaps = 5/78 (6%) Frame = +2 Query: 230 RRVVYRCXHCQFMDMLFPGSVPMKRIKFKTNLEH-----EYIQNFKILQAGFKKMGVDKI 394 RR C H +F P K K+ T L H E I NF L G D I Sbjct: 85 RRPHILCNHARFNKKPMNILFPKKDTKYLTILRHPVTHFESIFNFMKLWDSLNIKGRDSI 144 Query: 395 VPIDKLVKGRFQDNFEFL 448 +DK ++G N E+L Sbjct: 145 EIMDKFLQGNSSFNPEYL 162 >SB_25586| Best HMM Match : RVT_1 (HMM E-Value=2.3e-18) Length = 802 Score = 28.7 bits (61), Expect = 4.3 Identities = 21/68 (30%), Positives = 27/68 (39%), Gaps = 5/68 (7%) Frame = +2 Query: 440 EFLQWFKKFLTPTMEVRAYDAWATRRAAMGH-----RGSAXPKGRCR*ENRRPRSAKFAA 604 E+LQ K TP+ + A +A + GH +G A PK R P A A Sbjct: 103 EYLQALKTLKTPSTKCPALEAICNKCQKKGHFAKVCKGKAVPKERVSAATWSPILATLTA 162 Query: 605 RXPNHLGK 628 P L K Sbjct: 163 NPPKSLSK 170 >SB_3270| Best HMM Match : MMPL (HMM E-Value=0.68) Length = 401 Score = 28.7 bits (61), Expect = 4.3 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +3 Query: 168 LSRHDMLAWVNDCLQSNFAKIEELCTGAAIASSWTCCSL 284 L D+L W++ + AK + C + +WT CSL Sbjct: 47 LENVDVLMWIHSSAAKSLAKTKLRCLRLSWKQAWTPCSL 85 >SB_42659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 5834 Score = 27.5 bits (58), Expect = 9.9 Identities = 13/47 (27%), Positives = 19/47 (40%) Frame = +3 Query: 132 VNVYSTNVTSENLSRHDMLAWVNDCLQSNFAKIEELCTGAAIASSWT 272 V TN TS+ + + W DC + I +C G + WT Sbjct: 5374 VQTNGTNTTSDKICECEQGYWGEDCGKLCKGGIWNVCNGHGTCNRWT 5420 >SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 749 Score = 27.5 bits (58), Expect = 9.9 Identities = 9/34 (26%), Positives = 19/34 (55%) Frame = -3 Query: 355 YFKVLYIFMFQICLKFDSFHWYTAREQHVHELAM 254 Y V Y+F+F L++ H++ E+ +H+ + Sbjct: 595 YVMVCYVFVFCALLEYAVVHYFFVYEKQIHQFQL 628 >SB_19238| Best HMM Match : DUF729 (HMM E-Value=1.4) Length = 647 Score = 27.5 bits (58), Expect = 9.9 Identities = 18/64 (28%), Positives = 27/64 (42%), Gaps = 1/64 (1%) Frame = -1 Query: 354 ILKFCIYSCSKFVLNLILFIGTLPGNSMSMNWQWXHLYTTLRSSQ-SLTGDNHSPTLAYH 178 +LKF + S N F+ + PG ++ W LY LR S SL D + ++ Sbjct: 1 MLKFAVNGYSPPFFNAPEFVPSPPGTAIYKERGWDELYGLLRGSHVSLCSDYYGDAGFWY 60 Query: 177 AAID 166 D Sbjct: 61 PGCD 64 >SB_2066| Best HMM Match : Dynein_heavy (HMM E-Value=0) Length = 1256 Score = 27.5 bits (58), Expect = 9.9 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +1 Query: 202 IVSSQTLRRSKSCVQVXPLPVHGHAVPWQ 288 I+ S+TLR S C+ +P H V W+ Sbjct: 1053 IIMSETLRDSLDCMYDARIPTHWKKVSWE 1081 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,400,122 Number of Sequences: 59808 Number of extensions: 434354 Number of successful extensions: 1010 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 913 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1010 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1645141000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -