BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0119 (648 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g67270.1 68418.m08480 microtubule-associated EB1 family prote... 87 7e-18 At5g62500.1 68418.m07844 microtubule-associated EB1 family prote... 85 4e-17 At3g47690.1 68416.m05194 microtubule-associated EB1 family prote... 84 7e-17 At3g19090.1 68416.m02426 RNA-binding protein, putative similar t... 28 4.7 At4g06479.1 68417.m00885 hypothetical protein 28 6.1 At3g52720.2 68416.m05809 carbonic anhydrase family protein low s... 28 6.1 At3g52720.1 68416.m05808 carbonic anhydrase family protein low s... 28 6.1 >At5g67270.1 68418.m08480 microtubule-associated EB1 family protein similar to SP|Q9UPY8 Microtubule-associated protein RP/EB family member 3 (Protein EB3) {Homo sapiens}; contains Pfam profiles PF00307: Calponin homology (CH) domain, PF03271: EB1 protein Length = 329 Score = 87.4 bits (207), Expect = 7e-18 Identities = 36/71 (50%), Positives = 49/71 (69%) Frame = +2 Query: 254 HCQFMDMLFPGSVPMKRIKFKTNLEHEYIQNFKILQAGFKKMGVDKIVPIDKLVKGRFQD 433 HCQ MD + PG+VPM ++ F E+E IQN+K+LQ F K+ + K + + KLVKGR D Sbjct: 43 HCQLMDSVHPGTVPMHKVNFDAKSEYEMIQNYKVLQDVFNKLKITKHIEVSKLVKGRPLD 102 Query: 434 NFEFLQWFKKF 466 N EF+QW KK+ Sbjct: 103 NLEFMQWMKKY 113 Score = 38.7 bits (86), Expect = 0.003 Identities = 14/28 (50%), Positives = 21/28 (75%) Frame = +3 Query: 168 LSRHDMLAWVNDCLQSNFAKIEELCTGA 251 + R ++LAW+N LQ N +K+EE C+GA Sbjct: 14 VGRSEILAWINSTLQLNLSKVEEACSGA 41 >At5g62500.1 68418.m07844 microtubule-associated EB1 family protein similar to EBF3-S (Microtubule-associated protein) [Homo sapiens] GI:12751131; contains Pfam profiles PF00307: Calponin homology (CH) domain, PF03271: EB1 protein Length = 293 Score = 85.0 bits (201), Expect = 4e-17 Identities = 35/70 (50%), Positives = 50/70 (71%) Frame = +2 Query: 257 CQFMDMLFPGSVPMKRIKFKTNLEHEYIQNFKILQAGFKKMGVDKIVPIDKLVKGRFQDN 436 CQ +DM FPG VPM ++ F+ E+E IQN+K++Q F K+ + K + +++LVKGR DN Sbjct: 44 CQMLDMTFPGVVPMHKVNFEAKNEYEMIQNYKVMQEVFTKLKITKPLEVNRLVKGRPLDN 103 Query: 437 FEFLQWFKKF 466 EFLQW K+F Sbjct: 104 LEFLQWLKRF 113 Score = 33.5 bits (73), Expect = 0.12 Identities = 12/28 (42%), Positives = 21/28 (75%) Frame = +3 Query: 168 LSRHDMLAWVNDCLQSNFAKIEELCTGA 251 + R+++L+W+ND L N ++IEE +GA Sbjct: 14 VGRNEILSWINDRLHLNLSRIEEAASGA 41 >At3g47690.1 68416.m05194 microtubule-associated EB1 family protein similar to SP|Q9UPY8 Microtubule-associated protein RP/EB family member 3 (Protein EB3) {Homo sapiens}; contains Pfam profile PF03271: EB1 protein Length = 276 Score = 84.2 bits (199), Expect = 7e-17 Identities = 36/70 (51%), Positives = 49/70 (70%) Frame = +2 Query: 257 CQFMDMLFPGSVPMKRIKFKTNLEHEYIQNFKILQAGFKKMGVDKIVPIDKLVKGRFQDN 436 CQ +DM FPG VPM ++ F E++ IQN+K+LQ F K+ + K + I++LVKGR DN Sbjct: 44 CQMLDMTFPGVVPMHKVNFDAKNEYDMIQNYKVLQDVFNKLKITKPLEINRLVKGRPLDN 103 Query: 437 FEFLQWFKKF 466 EFLQW K+F Sbjct: 104 LEFLQWLKRF 113 Score = 32.7 bits (71), Expect = 0.22 Identities = 11/28 (39%), Positives = 20/28 (71%) Frame = +3 Query: 168 LSRHDMLAWVNDCLQSNFAKIEELCTGA 251 + R+++L W+ND L N +++EE +GA Sbjct: 14 VGRNEILTWINDRLHLNLSRVEEAASGA 41 >At3g19090.1 68416.m02426 RNA-binding protein, putative similar to RNA-binding protein homolog GB:AAF00075 GI:6449448 from [Brassica napus]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 455 Score = 28.3 bits (60), Expect = 4.7 Identities = 19/69 (27%), Positives = 32/69 (46%), Gaps = 1/69 (1%) Frame = -3 Query: 289 TAREQHVHELAMAAPVHNSSIFAKFDWRQSFTHASISCRD-RFSDVTFVEYTFTAIFTMY 113 TA+ QHVH+ A A + N ++ S + ++ D R V VEY FT + + Sbjct: 104 TAQHQHVHDPAAAFYISNPAVQFPASQNSSSSSKNLLSDDLRLKIVKQVEYQFTDMSLLA 163 Query: 112 QPLMKKFLT 86 + K ++ Sbjct: 164 NESISKHIS 172 >At4g06479.1 68417.m00885 hypothetical protein Length = 370 Score = 27.9 bits (59), Expect = 6.1 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -3 Query: 520 SPSRRPCVICPHLHSWRQEFLEPLQKL 440 +P++RPC IC H +E L P Q + Sbjct: 292 TPAKRPCEICSHTDHPTEECLYPPQTI 318 >At3g52720.2 68416.m05809 carbonic anhydrase family protein low similarity to storage protein (dioscorin) [Dioscorea cayenensis] GI:433463; contains Pfam profile PF00194: Eukaryotic-type carbonic anhydrase Length = 230 Score = 27.9 bits (59), Expect = 6.1 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -3 Query: 298 HWYTAREQHVHELAMAAPVH 239 HW+T E H+H + AA +H Sbjct: 119 HWHTPSEHHLHGVQYAAELH 138 >At3g52720.1 68416.m05808 carbonic anhydrase family protein low similarity to storage protein (dioscorin) [Dioscorea cayenensis] GI:433463; contains Pfam profile PF00194: Eukaryotic-type carbonic anhydrase Length = 284 Score = 27.9 bits (59), Expect = 6.1 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -3 Query: 298 HWYTAREQHVHELAMAAPVH 239 HW+T E H+H + AA +H Sbjct: 119 HWHTPSEHHLHGVQYAAELH 138 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,396,583 Number of Sequences: 28952 Number of extensions: 308150 Number of successful extensions: 727 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 705 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 727 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1344285648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -