BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0118 (698 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81587-6|CAB04704.1| 417|Caenorhabditis elegans Hypothetical pr... 29 2.4 Z81120-7|CAB03343.2| 274|Caenorhabditis elegans Hypothetical pr... 29 4.2 AC006618-3|AAK68251.3| 960|Caenorhabditis elegans Patched relat... 29 4.2 >Z81587-6|CAB04704.1| 417|Caenorhabditis elegans Hypothetical protein T06G6.8 protein. Length = 417 Score = 29.5 bits (63), Expect = 2.4 Identities = 27/119 (22%), Positives = 47/119 (39%), Gaps = 2/119 (1%) Frame = -1 Query: 623 GKVPRGRCFSW--SPDRMISAVISTLFSGTQMTDDRELAVSSSVVNSKYWKSFARAWTLT 450 G+ P G +W PD ++ + G T SS + S WK+ L Sbjct: 179 GRSPTGDS-AWFLKPDNYALCGLAGICEGPAQTSTAPSTRSSKLPTSSVWKATTTPSDLP 237 Query: 449 SLPSRSLNLNLACWVFALLCTSTVPSKSITFTNGVWAKKTNLVGETSNNSLETRSAPRE 273 + PSR+ +L A L T+T + + + ++ T + + L T+ + RE Sbjct: 238 TKPSRTRSLTSTSTTTAKLPTTTSTTFAAPQASTEPSEATEALATATPADLPTKPSGRE 296 >Z81120-7|CAB03343.2| 274|Caenorhabditis elegans Hypothetical protein T12D8.3 protein. Length = 274 Score = 28.7 bits (61), Expect = 4.2 Identities = 15/49 (30%), Positives = 22/49 (44%) Frame = -1 Query: 464 AWTLTSLPSRSLNLNLACWVFALLCTSTVPSKSITFTNGVWAKKTNLVG 318 +W S SRS + C + A L TS P +G+W K + +G Sbjct: 85 SWLANSQMSRSRAMEAYCELMAQLDTSWDPDAETVKKSGLWEKMPSTMG 133 >AC006618-3|AAK68251.3| 960|Caenorhabditis elegans Patched related family protein 4 protein. Length = 960 Score = 28.7 bits (61), Expect = 4.2 Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = -3 Query: 258 DYDSRI-YRFGSGTLKTAFDLMTTSLSSLGWKNPISAAIAS 139 DY I YR+ KTA + + +L+S+GW P++ A+ S Sbjct: 853 DYSVHICYRYHRSEYKTAQEKVADTLASVGW--PVTQAVCS 891 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,122,414 Number of Sequences: 27780 Number of extensions: 337829 Number of successful extensions: 866 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 833 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 866 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1613473434 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -