BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0116 (598 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0115 + 851505-852368,852611-852730,853000-853020,853253-85... 29 3.7 02_05_0352 + 28240913-28241362 29 3.7 08_01_0682 + 5974622-5974745,5976182-5976371,5976953-5977024,597... 28 4.9 07_03_0423 + 18035688-18036572,18036659-18036978,18052618-180527... 28 4.9 >07_01_0115 + 851505-852368,852611-852730,853000-853020,853253-853369, 853466-853555,853730-853837,853897-853932,853933-854022 Length = 481 Score = 28.7 bits (61), Expect = 3.7 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = -2 Query: 240 YRFGSGTLKTAFDLMTTSLSSLGWKNPISAAIAS 139 +R G T AFD MT +S+ NP+ AA++S Sbjct: 72 FRGGVATRSVAFDEMTPRRASVDVPNPLRAALSS 105 >02_05_0352 + 28240913-28241362 Length = 149 Score = 28.7 bits (61), Expect = 3.7 Identities = 17/49 (34%), Positives = 29/49 (59%), Gaps = 5/49 (10%) Frame = +3 Query: 54 RPASTWIRRNRDTRPLLDTSS----TSP-IIGIRKLLQPKSDSSTLDLI 185 R STW +R +RP + T+S T P ++G+RK +P+ + T +L+ Sbjct: 73 RTCSTWTSLSRTSRPTMATTSGVVKTLPELVGLRK--EPRWEDKTTELL 119 >08_01_0682 + 5974622-5974745,5976182-5976371,5976953-5977024, 5977482-5977553,5977688-5977759,5977842-5977913, 5978690-5978761,5978855-5978926,5979017-5979091, 5979529-5979594,5979821-5979885,5979975-5980354, 5980438-5980636,5980713-5980763,5980955-5981073, 5981190-5981400,5981524-5981755,5981842-5981992, 5982089-5982447,5982750-5982768 Length = 890 Score = 28.3 bits (60), Expect = 4.9 Identities = 21/71 (29%), Positives = 34/71 (47%) Frame = -1 Query: 235 IWFRDLEDCVRLDDYLLIKSRVEESDFGCNSFLIPIIGDVDEVSNRGLVSLFLLIQVEAG 56 +W D + ++ DYL +++ E F NSF PI + +SN L SL + V Sbjct: 177 LWASDNDFTGKIPDYLGTLTKLVELRFQGNSFQGPIPASLSNLSN--LTSLRIGDIVNGS 234 Query: 55 LSAEYIRRVTA 23 S +I +T+ Sbjct: 235 SSLAFISNLTS 245 >07_03_0423 + 18035688-18036572,18036659-18036978,18052618-18052724, 18053001-18053104,18054129-18054328,18054422-18054522, 18054695-18054841,18055007-18055166,18055287-18055368, 18056070-18056336,18056846-18056973,18057513-18057672 Length = 886 Score = 28.3 bits (60), Expect = 4.9 Identities = 17/55 (30%), Positives = 24/55 (43%) Frame = +1 Query: 193 SHQVERSLQGPGTKSIYSRIIVSLCHSSLGADRVSKLLLDVSPTKFVFLAQTPFV 357 S +++ + G T + Y R VSL + LGA V K + K T FV Sbjct: 521 SKEIDIIVNGAATTNFYERYDVSLASNVLGAKYVCKFAKKCANLKMFLHISTAFV 575 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,853,848 Number of Sequences: 37544 Number of extensions: 316538 Number of successful extensions: 707 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 697 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 707 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1423789920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -