BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0114 (499 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 22 3.1 DQ069332-1|AAZ32217.1| 296|Apis mellifera RNA polymerase II lar... 21 7.1 AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. 21 7.1 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 21 9.4 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 21 9.4 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 22.2 bits (45), Expect = 3.1 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -1 Query: 445 FCCPSHGLPGNSSQG 401 +CC + G PG+SS G Sbjct: 14 WCCDNLGGPGSSSAG 28 >DQ069332-1|AAZ32217.1| 296|Apis mellifera RNA polymerase II large subunit protein. Length = 296 Score = 21.0 bits (42), Expect = 7.1 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +3 Query: 399 QPCELFPGKPWEGQQ 443 QPC L P W G+Q Sbjct: 37 QPCILKPKPLWTGKQ 51 >AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. Length = 366 Score = 21.0 bits (42), Expect = 7.1 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +1 Query: 226 RDGKYFIAAVDVENQKYRETHWNATNTSKMRMSNS 330 R+GK + +EN+ E++ ++T T R S + Sbjct: 212 RNGKRKRKSSTIENESETESNASSTKTKMRRKSGA 246 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 20.6 bits (41), Expect = 9.4 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -3 Query: 275 YFWFSTSTAAMKYFPSLI 222 Y WF+TS + F LI Sbjct: 549 YIWFTTSGTISEKFRKLI 566 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 20.6 bits (41), Expect = 9.4 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -3 Query: 275 YFWFSTSTAAMKYFPSLI 222 Y WF+TS + F LI Sbjct: 602 YIWFTTSGTISEKFRKLI 619 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 154,794 Number of Sequences: 438 Number of extensions: 3748 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13618701 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -