BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0112 (598 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0115 + 851505-852368,852611-852730,853000-853020,853253-85... 29 3.7 02_05_0352 + 28240913-28241362 29 3.7 >07_01_0115 + 851505-852368,852611-852730,853000-853020,853253-853369, 853466-853555,853730-853837,853897-853932,853933-854022 Length = 481 Score = 28.7 bits (61), Expect = 3.7 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = -2 Query: 240 YRFGSGTLKTAFDLMTTSLSSLGWKNPISAAIAS 139 +R G T AFD MT +S+ NP+ AA++S Sbjct: 72 FRGGVATRSVAFDEMTPRRASVDVPNPLRAALSS 105 >02_05_0352 + 28240913-28241362 Length = 149 Score = 28.7 bits (61), Expect = 3.7 Identities = 17/49 (34%), Positives = 29/49 (59%), Gaps = 5/49 (10%) Frame = +3 Query: 54 RPASTWIRRNRDTRPLLDTSS----TSP-IIGIRKLLQPKSDSSTXDLI 185 R STW +R +RP + T+S T P ++G+RK +P+ + T +L+ Sbjct: 73 RTCSTWTSLSRTSRPTMATTSGVVKTLPELVGLRK--EPRWEDKTTELL 119 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,432,803 Number of Sequences: 37544 Number of extensions: 304506 Number of successful extensions: 628 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 620 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 628 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1423789920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -