BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0109 (499 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC16C4.14c |sfc4||transcription factor TFIIIC complex subunit ... 26 2.7 SPBC12C2.05c |||diacylglycerol binding protein Bzz1 |Schizosacch... 26 3.6 >SPCC16C4.14c |sfc4||transcription factor TFIIIC complex subunit Sfc4|Schizosaccharomyces pombe|chr 3|||Manual Length = 1006 Score = 26.2 bits (55), Expect = 2.7 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = -1 Query: 100 CSRHRNYSSNRHFLLEII*IPDRTRRNSLFS 8 CSR S+N+ FLL +I + D+ NSL S Sbjct: 790 CSRAFVDSANQKFLLRLIKLMDQLMSNSLVS 820 >SPBC12C2.05c |||diacylglycerol binding protein Bzz1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 642 Score = 25.8 bits (54), Expect = 3.6 Identities = 8/26 (30%), Positives = 17/26 (65%) Frame = +2 Query: 110 YNRSAPIIINNFQLLNQPRFTTITRL 187 YN + P ++N+ Q+LN+ R + + + Sbjct: 213 YNETLPTLLNHMQVLNEYRVSNLNEI 238 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,871,029 Number of Sequences: 5004 Number of extensions: 34646 Number of successful extensions: 57 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 56 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 57 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 196153982 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -