SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0109
         (499 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AC006801-2|AAF60751.1|  914|Caenorhabditis elegans Hypothetical ...    28   4.3  

>AC006801-2|AAF60751.1|  914|Caenorhabditis elegans Hypothetical
           protein Y52D5A.1 protein.
          Length = 914

 Score = 27.9 bits (59), Expect = 4.3
 Identities = 18/54 (33%), Positives = 28/54 (51%)
 Frame = -3

Query: 446 IFVYNSISCRLIFEKP*SLATFILNVIYIFKXLKKSLIPTLNTLYILTAFGNLV 285
           I+++  +S   IF+ P S + F L VIYIF  +  S+   L  +YI     N +
Sbjct: 468 IYIFLKMS-NSIFDLPMSNSIFDLPVIYIFLKMSNSIF-DLPVIYIFLKMSNSI 519


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,265,755
Number of Sequences: 27780
Number of extensions: 188818
Number of successful extensions: 425
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 420
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 425
length of database: 12,740,198
effective HSP length: 76
effective length of database: 10,628,918
effective search space used: 945973702
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -