SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0108
         (498 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY884063-1|AAX84204.1|  682|Tribolium castaneum pro-phenol oxida...    22   3.5  
AY362543-1|AAQ63455.1|  677|Tribolium castaneum chitin synthase ...    21   6.2  
AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ...    21   6.2  
AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ...    21   6.2  
AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ...    21   6.2  
AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ...    21   6.2  
AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ...    21   6.2  
AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ...    21   6.2  
AM712901-1|CAN84640.1|  205|Tribolium castaneum hypothetical pro...    21   6.2  
AM292360-1|CAL23172.2|  427|Tribolium castaneum gustatory recept...    21   8.1  
AM292331-1|CAL23143.2|  437|Tribolium castaneum gustatory recept...    21   8.1  
AJ850290-1|CAH64510.1|  533|Tribolium castaneum putative esteras...    21   8.1  

>AY884063-1|AAX84204.1|  682|Tribolium castaneum pro-phenol oxidase
           subunit 1 protein.
          Length = 682

 Score = 21.8 bits (44), Expect = 3.5
 Identities = 8/15 (53%), Positives = 10/15 (66%)
 Frame = +1

Query: 343 RWRDMVAPHRHTGVV 387
           RWRD +    H+GVV
Sbjct: 310 RWRDRIYDAIHSGVV 324


>AY362543-1|AAQ63455.1|  677|Tribolium castaneum chitin synthase
           protein.
          Length = 677

 Score = 21.0 bits (42), Expect = 6.2
 Identities = 6/12 (50%), Positives = 7/12 (58%)
 Frame = -1

Query: 435 VNYDXGNETWTC 400
           V YD G + W C
Sbjct: 573 VQYDQGEDRWLC 584


>AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase
           variant 2 protein.
          Length = 1558

 Score = 21.0 bits (42), Expect = 6.2
 Identities = 6/12 (50%), Positives = 7/12 (58%)
 Frame = -1

Query: 435 VNYDXGNETWTC 400
           V YD G + W C
Sbjct: 833 VQYDQGEDRWLC 844


>AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase
           variant 1 protein.
          Length = 1558

 Score = 21.0 bits (42), Expect = 6.2
 Identities = 6/12 (50%), Positives = 7/12 (58%)
 Frame = -1

Query: 435 VNYDXGNETWTC 400
           V YD G + W C
Sbjct: 833 VQYDQGEDRWLC 844


>AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase
           protein.
          Length = 1464

 Score = 21.0 bits (42), Expect = 6.2
 Identities = 6/12 (50%), Positives = 7/12 (58%)
 Frame = -1

Query: 435 VNYDXGNETWTC 400
           V YD G + W C
Sbjct: 806 VQYDQGEDRWLC 817


>AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase
           CHS2 protein.
          Length = 1464

 Score = 21.0 bits (42), Expect = 6.2
 Identities = 6/12 (50%), Positives = 7/12 (58%)
 Frame = -1

Query: 435 VNYDXGNETWTC 400
           V YD G + W C
Sbjct: 806 VQYDQGEDRWLC 817


>AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase
           CHS1B protein.
          Length = 1558

 Score = 21.0 bits (42), Expect = 6.2
 Identities = 6/12 (50%), Positives = 7/12 (58%)
 Frame = -1

Query: 435 VNYDXGNETWTC 400
           V YD G + W C
Sbjct: 833 VQYDQGEDRWLC 844


>AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase
           CHS1A protein.
          Length = 1558

 Score = 21.0 bits (42), Expect = 6.2
 Identities = 6/12 (50%), Positives = 7/12 (58%)
 Frame = -1

Query: 435 VNYDXGNETWTC 400
           V YD G + W C
Sbjct: 833 VQYDQGEDRWLC 844


>AM712901-1|CAN84640.1|  205|Tribolium castaneum hypothetical
           protein protein.
          Length = 205

 Score = 21.0 bits (42), Expect = 6.2
 Identities = 10/35 (28%), Positives = 16/35 (45%)
 Frame = -3

Query: 259 TKRILYFPLCTDLWECRYHQLLRTFRKRGVSLQAS 155
           T    +F +C D        ++  FRKR V+ + S
Sbjct: 72  THIFFFFAICCDFIALIVVNIVHVFRKRRVNYKDS 106


>AM292360-1|CAL23172.2|  427|Tribolium castaneum gustatory receptor
           candidate 39 protein.
          Length = 427

 Score = 20.6 bits (41), Expect = 8.1
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = +2

Query: 20  NLTTLYYSICLI 55
           NLT + YS+C+I
Sbjct: 173 NLTLITYSLCVI 184


>AM292331-1|CAL23143.2|  437|Tribolium castaneum gustatory receptor
           candidate 10 protein.
          Length = 437

 Score = 20.6 bits (41), Expect = 8.1
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = +2

Query: 20  NLTTLYYSICLI 55
           NLT + YS+C+I
Sbjct: 173 NLTLITYSLCVI 184


>AJ850290-1|CAH64510.1|  533|Tribolium castaneum putative esterase
           protein.
          Length = 533

 Score = 20.6 bits (41), Expect = 8.1
 Identities = 6/14 (42%), Positives = 11/14 (78%)
 Frame = -2

Query: 266 NPHEANPLLSLVYR 225
           NP E NPL+++ ++
Sbjct: 478 NPSEENPLINVTWK 491


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 95,168
Number of Sequences: 336
Number of extensions: 1745
Number of successful extensions: 14
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 14
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 14
length of database: 122,585
effective HSP length: 53
effective length of database: 104,777
effective search space used: 11735024
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)

- SilkBase 1999-2023 -