BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0108 (498 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 23 1.8 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 23 1.8 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 23 1.8 AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 22 4.1 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 21 7.1 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 23.0 bits (47), Expect = 1.8 Identities = 7/21 (33%), Positives = 12/21 (57%) Frame = +1 Query: 274 VVTLKKPWTRWTDECXTAGNF 336 +V++ K W +W D T N+ Sbjct: 689 LVSVNKSWNKWNDWQETQNNY 709 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 23.0 bits (47), Expect = 1.8 Identities = 7/21 (33%), Positives = 12/21 (57%) Frame = +1 Query: 274 VVTLKKPWTRWTDECXTAGNF 336 +V++ K W +W D T N+ Sbjct: 689 LVSVNKSWNKWNDWQETQNNY 709 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 23.0 bits (47), Expect = 1.8 Identities = 7/21 (33%), Positives = 12/21 (57%) Frame = +1 Query: 274 VVTLKKPWTRWTDECXTAGNF 336 +V++ K W +W D T N+ Sbjct: 689 LVSVNKSWNKWNDWQETQNNY 709 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 21.8 bits (44), Expect = 4.1 Identities = 13/36 (36%), Positives = 15/36 (41%) Frame = +1 Query: 280 TLKKPWTRWTDECXTAGNFAFRWRDMVAPHRHTGVV 387 T+ K R DE RWRD + HTG V Sbjct: 291 TVLKDINRQVDELNFDIQDLERWRDRIYEAIHTGSV 326 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 21.0 bits (42), Expect = 7.1 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +3 Query: 177 RFRKVRRSW*YLHSQRS 227 R+ R+ W YLH RS Sbjct: 722 RYYPRRKEWLYLHRARS 738 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 114,828 Number of Sequences: 438 Number of extensions: 2155 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13618701 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -