Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0100
         (648 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q6ILW5 Cluster: HDC08196; n=1; Drosophila melanogaster|...    35   2.0  

>UniRef50_Q6ILW5 Cluster: HDC08196; n=1; Drosophila
           melanogaster|Rep: HDC08196 - Drosophila melanogaster
           (Fruit fly)
          Length = 136

 Score = 34.7 bits (76), Expect = 2.0
 Identities = 21/71 (29%), Positives = 35/71 (49%), Gaps = 1/71 (1%)
 Frame = -3

Query: 496 SLSFFRIFASLDFFFKNFSTAATLLGFDALFDF-PQLEHLAFDLVDIMDTALRQGRTPFE 320
           SLS +   + + F+F+   T   ++   ++     Q+ HL +   D ++  LR G  PF 
Sbjct: 34  SLSGYSYMSHIHFYFRKCVTGNGVINSTSVTPSRSQMNHLWWSAFDFVEKLLR-GFWPFA 92

Query: 319 VVFFKHFSGFW 287
              F+ FSGFW
Sbjct: 93  FCSFECFSGFW 103


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 582,767,692
Number of Sequences: 1657284
Number of extensions: 11058290
Number of successful extensions: 26942
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 26039
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 26932
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 48955894634
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)