BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0099 (720 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY334011-1|AAR01136.1| 188|Anopheles gambiae beta-tubulin protein. 122 1e-29 AY334010-1|AAR01135.1| 188|Anopheles gambiae beta-tubulin protein. 122 1e-29 AY334009-1|AAR01134.1| 188|Anopheles gambiae beta-tubulin protein. 122 1e-29 AY334008-1|AAR01133.1| 188|Anopheles gambiae beta-tubulin protein. 122 1e-29 AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical prote... 26 1.0 AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical prote... 26 1.0 CR954256-8|CAJ14149.1| 247|Anopheles gambiae putative signal pe... 23 9.5 >AY334011-1|AAR01136.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 122 bits (294), Expect = 1e-29 Identities = 55/60 (91%), Positives = 58/60 (96%) Frame = +2 Query: 2 MSGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQ 181 MSG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT Q Sbjct: 129 MSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQ 188 >AY334010-1|AAR01135.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 122 bits (294), Expect = 1e-29 Identities = 55/60 (91%), Positives = 58/60 (96%) Frame = +2 Query: 2 MSGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQ 181 MSG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT Q Sbjct: 129 MSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQ 188 >AY334009-1|AAR01134.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 122 bits (294), Expect = 1e-29 Identities = 55/60 (91%), Positives = 58/60 (96%) Frame = +2 Query: 2 MSGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQ 181 MSG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT Q Sbjct: 129 MSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQ 188 >AY334008-1|AAR01133.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 122 bits (294), Expect = 1e-29 Identities = 55/60 (91%), Positives = 58/60 (96%) Frame = +2 Query: 2 MSGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQ 181 MSG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT Q Sbjct: 129 MSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQ 188 >AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 26.2 bits (55), Expect = 1.0 Identities = 14/53 (26%), Positives = 19/53 (35%) Frame = +2 Query: 389 KWLRPSLVTRRXYRPYSRGCLSSSWLXLRRKASCTGTLVRYG*NGVHGRQSPT 547 +W R RR PY G + +W L +C L+ G G T Sbjct: 117 RWTRSGATGRRQPHPYRAGRVGQTWQRLLSVTTCGLLLLLLGATVCRGANGAT 169 >AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 26.2 bits (55), Expect = 1.0 Identities = 14/53 (26%), Positives = 19/53 (35%) Frame = +2 Query: 389 KWLRPSLVTRRXYRPYSRGCLSSSWLXLRRKASCTGTLVRYG*NGVHGRQSPT 547 +W R RR PY G + +W L +C L+ G G T Sbjct: 117 RWTRSGATGRRQPHPYRAGRVGQTWQRLLSVTTCGLLLLLLGATVCRGANGAT 169 >CR954256-8|CAJ14149.1| 247|Anopheles gambiae putative signal peptidase protein. Length = 247 Score = 23.0 bits (47), Expect = 9.5 Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 2/31 (6%) Frame = -1 Query: 387 KTPRRYVTHGNLAVIGYPLDKI--RAVFVLN 301 K+P + V H +IG P D+I RA F LN Sbjct: 71 KSPTKPVQHVCKRIIGMPGDRIMTRASFNLN 101 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 749,095 Number of Sequences: 2352 Number of extensions: 14785 Number of successful extensions: 24 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 73181328 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -