BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0091 (548 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 23 1.5 DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 23 2.0 AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydroge... 21 6.2 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 21 8.2 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 21 8.2 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 23.4 bits (48), Expect = 1.5 Identities = 9/31 (29%), Positives = 20/31 (64%) Frame = +2 Query: 8 VFKNFKMKTLIFIMLVACVASQRTVLWYVVQ 100 +FK FK + +++++ AC+ + LW V++ Sbjct: 431 LFKTFKDRKYLYMLMEACLGGE---LWTVLR 458 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 23.0 bits (47), Expect = 2.0 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = -2 Query: 226 HLHQVKXHKRDNKHTFQRVWRDAQ 155 ++ +VK K +KH Q W D + Sbjct: 325 YIPKVKNKKAGSKHLLQNTWLDPE 348 >AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydrogenase/reductase protein. Length = 246 Score = 21.4 bits (43), Expect = 6.2 Identities = 14/43 (32%), Positives = 17/43 (39%) Frame = +1 Query: 145 PKNTEHRARHAGKCACCPACVXLLGEGATCKIYSKELAKPPPL 273 P N A A KCA L E A C+ K ++ P L Sbjct: 153 PMNRNRPAYLASKCALTTLTDCLRSELAQCESNIKVISISPDL 195 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 21.0 bits (42), Expect = 8.2 Identities = 8/23 (34%), Positives = 11/23 (47%) Frame = +1 Query: 163 RARHAGKCACCPACVXLLGEGAT 231 + RH CC C L G G++ Sbjct: 3 KGRHVVMSCCCWCCDNLGGPGSS 25 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.0 bits (42), Expect = 8.2 Identities = 7/24 (29%), Positives = 13/24 (54%) Frame = +2 Query: 206 SFYLVKVQLARFIRRNWRNPLRCV 277 ++ L + +L + WRN RC+ Sbjct: 104 TYQLTETELVFGAKLAWRNATRCI 127 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,722 Number of Sequences: 438 Number of extensions: 3003 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15704448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -