BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0075 (598 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_02_0607 - 11183382-11183387,11183481-11183637,11184220-111842... 31 0.70 12_02_0122 + 13923510-13925081 28 6.5 05_07_0296 - 29061900-29061923,29062026-29062440,29062529-290625... 27 8.6 03_02_0900 - 12262149-12262565,12262924-12263061,12263387-122634... 27 8.6 >09_02_0607 - 11183382-11183387,11183481-11183637,11184220-11184284, 11184397-11184469,11184759-11184905,11185515-11185562, 11185637-11185716,11186112-11186439,11186525-11186576, 11187397-11187523,11187613-11187990 Length = 486 Score = 31.1 bits (67), Expect = 0.70 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = -1 Query: 121 GFQRVPPLSCYPGHAKLSYSAPWSPD 44 GF+R+P L C+P +L+ WSP+ Sbjct: 202 GFKRIPSLECWPDVLQLTEPENWSPN 227 >12_02_0122 + 13923510-13925081 Length = 523 Score = 27.9 bits (59), Expect = 6.5 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = +1 Query: 478 ARRIWPGLRT*QRSIQVFRDCRS*IXSRFLETRLWYYPS 594 ARR+ L RS+QV D + F LW+YPS Sbjct: 85 ARRLKADLGRDARSVQVSVDDHQEVTDSFRGATLWWYPS 123 >05_07_0296 - 29061900-29061923,29062026-29062440,29062529-29062566, 29062689-29062741,29062851-29063034,29064486-29064669, 29064761-29064916,29064998-29065173,29065277-29065454, 29066015-29066421 Length = 604 Score = 27.5 bits (58), Expect = 8.6 Identities = 22/64 (34%), Positives = 30/64 (46%), Gaps = 1/64 (1%) Frame = +3 Query: 264 LSEKILYSHLDDPKGQEIERGASYLRLRPDRVA-MQDATAQMAMLQFISSGLPRVAVPST 440 LS +L+S DDP+ + AS + L PDR+A + A A S G P A Sbjct: 20 LSRALLFSQ-DDPEPVKRPDEASSISLPPDRIAIIAAAPAPSPATAAASDGSPAPA-QDE 77 Query: 441 IHCD 452 + CD Sbjct: 78 VRCD 81 >03_02_0900 - 12262149-12262565,12262924-12263061,12263387-12263446, 12263557-12263619,12264181-12264243,12264420-12264482, 12265076-12265153,12265673-12266080 Length = 429 Score = 27.5 bits (58), Expect = 8.6 Identities = 17/74 (22%), Positives = 29/74 (39%), Gaps = 1/74 (1%) Frame = +3 Query: 294 DDPKGQEIERGASYLRLRPDRVAMQDATAQMAMLQFISSGLP-RVAVPSTIHCDHLIEAQ 470 DD E Y PDR A D+T ++ + G+P + P+ H +H + + Sbjct: 50 DDAMSTVGEEAPQYQNHEPDRQANHDSTNTDDVMSSVGEGIPFQNLDPAMTHENHKVSST 109 Query: 471 VGGEKDLARAKDLT 512 ++ D T Sbjct: 110 AHADQRSVEMSDST 123 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,060,561 Number of Sequences: 37544 Number of extensions: 366244 Number of successful extensions: 947 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 929 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 947 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1423789920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -