BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0071 (548 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 25 0.38 DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 25 0.67 AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 23 2.0 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 22 4.7 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 4.7 L01589-1|AAA27736.1| 81|Apis mellifera zinc finger protein pro... 21 8.2 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 21 8.2 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 21 8.2 DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 21 8.2 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 21 8.2 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 25.4 bits (53), Expect = 0.38 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = -1 Query: 194 FWRRTFAASARVQLKLDTVELLATSAAQSQ 105 FW + AA ARV L + ++ L+T A+SQ Sbjct: 266 FWIKPEAAPARVTLGVTSLLTLSTQHAKSQ 295 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 24.6 bits (51), Expect = 0.67 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -1 Query: 194 FWRRTFAASARVQLKLDTVELLATSAAQSQ 105 FW + A ARV L + ++ LAT QSQ Sbjct: 235 FWIKPEAIPARVTLGVTSLLTLATQNTQSQ 264 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 23.0 bits (47), Expect = 2.0 Identities = 7/30 (23%), Positives = 15/30 (50%) Frame = -1 Query: 497 VYQCKKAFRLNIATNCSDTLLNMVCMAVVL 408 +Y CK+ + AT+C ++ C ++ Sbjct: 171 LYNCKRTATITAATDCQLWAIDRQCFQTIM 200 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 21.8 bits (44), Expect = 4.7 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = -1 Query: 194 FWRRTFAASARVQLKLDTVELLAT 123 FW A SARV L + TV + T Sbjct: 263 FWINHEATSARVALGITTVLTMTT 286 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.8 bits (44), Expect = 4.7 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -3 Query: 240 TVKYLPCRGSHATIMFLASNICSVSSGT 157 T KY+ +A + LAS I S S+GT Sbjct: 2 TAKYVFTTLINAAFLCLASTILSESAGT 29 >L01589-1|AAA27736.1| 81|Apis mellifera zinc finger protein protein. Length = 81 Score = 21.0 bits (42), Expect = 8.2 Identities = 8/29 (27%), Positives = 12/29 (41%) Frame = +1 Query: 91 AFLHPWLCAADVARSSTVSSFNCTRADAA 177 AF PWL + + F+C + A Sbjct: 51 AFSRPWLLQGHIRTHTGEKPFSCQHCNRA 79 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 21.0 bits (42), Expect = 8.2 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = +2 Query: 23 RFPGQLNADLRKLAVNMVPXPRLHFYTP 106 R+ G L A RKL N + YTP Sbjct: 392 RYYGSLQAAARKLLGNAPEVENIWDYTP 419 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 21.0 bits (42), Expect = 8.2 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -3 Query: 495 VPVQEGFPPKHSHELLRHPL 436 +PV + FP ++ HE PL Sbjct: 450 LPVLKNFPTRYIHEPWNAPL 469 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.0 bits (42), Expect = 8.2 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = -1 Query: 194 FWRRTFAASARVQLKLDTVELLATSAA 114 FW A ARV L + T+ +AT + Sbjct: 263 FWLDQSAVPARVSLGVTTLLTMATQTS 289 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.0 bits (42), Expect = 8.2 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = -1 Query: 194 FWRRTFAASARVQLKLDTVELLATSAA 114 FW A ARV L + T+ +AT + Sbjct: 263 FWLDQSAVPARVSLGVTTLLTMATQTS 289 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 158,640 Number of Sequences: 438 Number of extensions: 3232 Number of successful extensions: 10 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15704448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -