BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0070 (594 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g46800.1 68416.m05080 DC1 domain-containing protein contains ... 30 1.3 At2g31440.1 68415.m03841 expressed protein identical to cDNA end... 28 5.4 >At3g46800.1 68416.m05080 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 682 Score = 29.9 bits (64), Expect = 1.3 Identities = 25/86 (29%), Positives = 38/86 (44%), Gaps = 11/86 (12%) Frame = +1 Query: 76 YGALVC---GTDYCEKNPCIQ--PPLVCPKNTEHRXRHAGKXA--CCPACVTXLGEGATC 234 YG VC G D C++ P + P + +H + K CC C++ L G C Sbjct: 34 YGGYVCNEVGCDTLFHKECVESVPEIKHPSHPQHPLKLNLKCGRFCCSLCISGLQVGYHC 93 Query: 235 KI--YSKEL--AKPPPLCVRSLSNAS 300 I ++ L A+ PP S S++S Sbjct: 94 SICDFNVHLVCARRPPSSTSSSSSSS 119 >At2g31440.1 68415.m03841 expressed protein identical to cDNA endonuclease III homologue (nth1 gene) GI:11181951 Length = 250 Score = 27.9 bits (59), Expect = 5.4 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -1 Query: 150 LRANKWWLYAWIFFTVVC 97 L+AN WW YA + T VC Sbjct: 59 LKANVWWPYALLVITSVC 76 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,289,187 Number of Sequences: 28952 Number of extensions: 237269 Number of successful extensions: 517 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 510 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 517 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1180950720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -