BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0068 (548 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A6ERK7 Cluster: Hyalin repeat protein; n=1; unidentifie... 36 0.47 UniRef50_Q5DFV6 Cluster: SJCHGC09529 protein; n=2; Schistosoma j... 33 4.4 UniRef50_Q55FJ5 Cluster: RNA polymerase III subunit; n=1; Dictyo... 33 4.4 >UniRef50_A6ERK7 Cluster: Hyalin repeat protein; n=1; unidentified eubacterium SCB49|Rep: Hyalin repeat protein - unidentified eubacterium SCB49 Length = 1008 Score = 36.3 bits (80), Expect = 0.47 Identities = 11/31 (35%), Positives = 23/31 (74%) Frame = -3 Query: 138 NFVKKYAFIFVVCFISTQSSHQRNEFSVMNN 46 N + +Y F+F++CF+ST ++ + N F+ +N+ Sbjct: 2 NKITQYVFVFIMCFLSTLNAQEENSFTSLNS 32 >UniRef50_Q5DFV6 Cluster: SJCHGC09529 protein; n=2; Schistosoma japonicum|Rep: SJCHGC09529 protein - Schistosoma japonicum (Blood fluke) Length = 507 Score = 33.1 bits (72), Expect = 4.4 Identities = 14/38 (36%), Positives = 25/38 (65%) Frame = +3 Query: 243 IRLLDKYSFLCEMYDEDADEIKDLTLIIFHLTFGSNNR 356 I+L DKYSFL + Y+ D + + ++L +F+ +NN+ Sbjct: 265 IKLFDKYSFLSKQYNADLEVYQIISLQLFNNNNNNNNQ 302 >UniRef50_Q55FJ5 Cluster: RNA polymerase III subunit; n=1; Dictyostelium discoideum AX4|Rep: RNA polymerase III subunit - Dictyostelium discoideum AX4 Length = 666 Score = 33.1 bits (72), Expect = 4.4 Identities = 16/44 (36%), Positives = 24/44 (54%) Frame = +3 Query: 276 EMYDEDADEIKDLTLIIFHLTFGSNNRREXRQKCFETSTTTTLK 407 ++YDED DE DL +I ++ N+ + T+TTTT K Sbjct: 297 DIYDEDDDEEPDLLVIEENVEINVNDHNSANKNSTTTTTTTTTK 340 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 433,478,277 Number of Sequences: 1657284 Number of extensions: 6651857 Number of successful extensions: 13012 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 12715 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13005 length of database: 575,637,011 effective HSP length: 96 effective length of database: 416,537,747 effective search space used: 35822246242 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -