BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0068 (548 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY843205-1|AAX14774.1| 478|Anopheles gambiae odorant receptor O... 25 1.6 AY363726-1|AAR14939.1| 331|Anopheles gambiae seven transmembran... 25 1.6 AY363725-1|AAR14938.1| 478|Anopheles gambiae seven transmembran... 25 1.6 AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcript... 25 1.6 AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking p... 23 8.8 >AY843205-1|AAX14774.1| 478|Anopheles gambiae odorant receptor Or83b protein. Length = 478 Score = 25.0 bits (52), Expect = 1.6 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = -1 Query: 86 NLLIKETNSLL*IMYICHYY 27 N LI+E++S++ Y CH+Y Sbjct: 405 NRLIEESSSVMEAAYSCHWY 424 >AY363726-1|AAR14939.1| 331|Anopheles gambiae seven transmembrane G protein-coupledreceptor protein. Length = 331 Score = 25.0 bits (52), Expect = 1.6 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = -1 Query: 86 NLLIKETNSLL*IMYICHYY 27 N LI+E++S++ Y CH+Y Sbjct: 258 NRLIEESSSVMKAAYSCHWY 277 >AY363725-1|AAR14938.1| 478|Anopheles gambiae seven transmembrane G protein-coupledreceptor protein. Length = 478 Score = 25.0 bits (52), Expect = 1.6 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = -1 Query: 86 NLLIKETNSLL*IMYICHYY 27 N LI+E++S++ Y CH+Y Sbjct: 405 NRLIEESSSVMEAAYSCHWY 424 >AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcriptase protein. Length = 988 Score = 25.0 bits (52), Expect = 1.6 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = +3 Query: 288 EDADEIKDLTLIIFHLTFGSNNRREXRQKCFETST 392 E D ++D+ ++FH R E +Q+C T Sbjct: 940 ECGDAVEDVEHVLFHCPRSDRIRNEMQQRCHSRVT 974 >AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking protein. Length = 932 Score = 22.6 bits (46), Expect = 8.8 Identities = 11/37 (29%), Positives = 21/37 (56%), Gaps = 2/37 (5%) Frame = +3 Query: 297 DEIKDLTLIIFHLTFGSNNRRE--XRQKCFETSTTTT 401 D +K++T ++ +GSN+ +E +C T+ T T Sbjct: 103 DIVKNVTRVVVQGCWGSNDDQESCSSNECVSTTETPT 139 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 483,215 Number of Sequences: 2352 Number of extensions: 7994 Number of successful extensions: 16 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 50881347 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -