BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0065 (499 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ555537-1|CAD88245.1| 210|Apis mellifera putative chemosensory... 25 0.44 AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. 23 2.3 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 21 9.4 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 21 9.4 >AJ555537-1|CAD88245.1| 210|Apis mellifera putative chemosensory receptor 2 protein. Length = 210 Score = 25.0 bits (52), Expect = 0.44 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = -3 Query: 86 NLLIKETNSLL*IMYICHYY 27 N LI+E++S++ Y CH+Y Sbjct: 178 NRLIEESSSVMEAAYSCHWY 197 >AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. Length = 349 Score = 22.6 bits (46), Expect = 2.3 Identities = 10/32 (31%), Positives = 13/32 (40%) Frame = +2 Query: 302 NKRFNPQLFSI*QFGSNNRREERPKCFETRTT 397 N NP ++ N+ RP ETR T Sbjct: 308 NSCMNPIVYGAFNIRDRNKTSARPTTIETRVT 339 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 20.6 bits (41), Expect = 9.4 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -2 Query: 129 KKYAFIFVVCFIS 91 +K FI +VCF+S Sbjct: 414 RKELFIAIVCFVS 426 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 20.6 bits (41), Expect = 9.4 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -2 Query: 129 KKYAFIFVVCFIS 91 +K FI +VCF+S Sbjct: 467 RKELFIAIVCFVS 479 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 117,350 Number of Sequences: 438 Number of extensions: 2045 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13618701 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -