BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0064 (499 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value L01617-1|AAA30097.1| 46|Tribolium castaneum zinc finger protei... 23 2.0 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 21 6.2 >L01617-1|AAA30097.1| 46|Tribolium castaneum zinc finger protein protein. Length = 46 Score = 22.6 bits (46), Expect = 2.0 Identities = 9/29 (31%), Positives = 13/29 (44%) Frame = +3 Query: 96 AFLHPWLXAADVARSSTVSSFNCTRADAA 182 AF PWL + + F+CT + A Sbjct: 16 AFSRPWLLQGHIRTHTGEKPFSCTYCNRA 44 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 21.0 bits (42), Expect = 6.2 Identities = 9/39 (23%), Positives = 18/39 (46%) Frame = +3 Query: 78 GAVSAPAFLHPWLXAADVARSSTVSSFNCTRADAANVRR 194 G S P ++PW+ + +S+ ++ R +RR Sbjct: 192 GQSSNPPQIYPWMKRVHLGQSTVNANGETKRQRTRAIRR 230 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 97,547 Number of Sequences: 336 Number of extensions: 1657 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11735024 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -