BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0063 (486 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY750997-1|AAV31069.1| 153|Anopheles gambiae peritrophin-1 prot... 25 1.8 AY344823-1|AAR02434.1| 153|Anopheles gambiae peritrophin A prot... 25 1.8 AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbona... 25 1.8 U89803-1|AAD03794.1| 250|Anopheles gambiae Tc1-like transposase... 23 7.3 DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 23 7.3 AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 22 9.7 >AY750997-1|AAV31069.1| 153|Anopheles gambiae peritrophin-1 protein. Length = 153 Score = 24.6 bits (51), Expect = 1.8 Identities = 13/27 (48%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = -1 Query: 435 VTILSGPV-ADISQHPNHDSEQPPXLL 358 V +L+ V AD+ P D EQPP LL Sbjct: 8 VLLLAAAVLADVRCPPQDDPEQPPVLL 34 >AY344823-1|AAR02434.1| 153|Anopheles gambiae peritrophin A protein. Length = 153 Score = 24.6 bits (51), Expect = 1.8 Identities = 13/27 (48%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = -1 Query: 435 VTILSGPV-ADISQHPNHDSEQPPXLL 358 V +L+ V AD+ P D EQPP LL Sbjct: 8 VLLLAAAVLADVRCPPQDDPEQPPVLL 34 >AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbonate anion exchanger protein. Length = 1102 Score = 24.6 bits (51), Expect = 1.8 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = -3 Query: 430 NIKRPSRRHFPTSEPRQRTASRXLEDRGATTRSEAQR 320 +I SRRH + ASR D+G +T SEA+R Sbjct: 41 HIPGSSRRHSQRRRHKHHQASRENGDKG-STGSEAER 76 >U89803-1|AAD03794.1| 250|Anopheles gambiae Tc1-like transposase protein. Length = 250 Score = 22.6 bits (46), Expect = 7.3 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +2 Query: 335 PRRGTAVFKXSGGCSLSWFGCWEMSATGPL 424 P+ FK GG SL +GC+ GPL Sbjct: 89 PKYCFKTFKHGGG-SLMVWGCFSYYGMGPL 117 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 22.6 bits (46), Expect = 7.3 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 426 LSGPVADISQHPNHDSEQPPXLLKTAVPRRGA 331 L+G + ++S H +E P + KTAV R A Sbjct: 238 LNGSIQELSAMVPHVAESPRRVDKTAVLRFSA 269 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 22.2 bits (45), Expect = 9.7 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = -1 Query: 324 NARSTSILVRGASLGNGDSVTSNAI 250 +A S S++ G ++ NG S +NA+ Sbjct: 1889 SAVSNSVVATGQAVNNGTSNNNNAL 1913 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 480,134 Number of Sequences: 2352 Number of extensions: 8001 Number of successful extensions: 14 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 42708759 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -