Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0062
         (548 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB253415-1|BAE86926.1|  588|Apis mellifera alpha-glucosidase pro...    22   3.6  
AY242387-1|AAO72539.2|  693|Apis mellifera prophenoloxidase prot...    21   6.2  

>AB253415-1|BAE86926.1|  588|Apis mellifera alpha-glucosidase
           protein.
          Length = 588

 Score = 22.2 bits (45), Expect = 3.6
 Identities = 12/35 (34%), Positives = 17/35 (48%)
 Frame = +2

Query: 410 KTYTPNXVARATVNXLLRTVPAAVPGVTFLSGGSS 514
           K YT +  +  TVN  +  V   +PG T +   SS
Sbjct: 529 KIYTSSVNSNLTVNQTVNPVAINIPGDTSIIVDSS 563


>AY242387-1|AAO72539.2|  693|Apis mellifera prophenoloxidase
           protein.
          Length = 693

 Score = 21.4 bits (43), Expect = 6.2
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +2

Query: 149 WPQHPLVP 172
           WPQH L+P
Sbjct: 583 WPQHMLIP 590


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 144,336
Number of Sequences: 438
Number of extensions: 3048
Number of successful extensions: 6
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 146,343
effective HSP length: 54
effective length of database: 122,691
effective search space used: 15704448
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)