BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0056 (499 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 24 0.77 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 23 1.8 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 22 4.1 AB208107-1|BAE72139.1| 71|Apis mellifera Broad complex zinc fi... 22 4.1 U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodops... 21 7.1 DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 21 7.1 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 21 7.1 AY703752-1|AAU12748.1| 152|Apis mellifera long-wavelength rhodo... 21 7.1 DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 21 9.4 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 21 9.4 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 21 9.4 DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride c... 21 9.4 DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride c... 21 9.4 AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl sub... 21 9.4 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 24.2 bits (50), Expect = 0.77 Identities = 16/65 (24%), Positives = 30/65 (46%), Gaps = 1/65 (1%) Frame = +2 Query: 38 VHLSKQKQTQDKMC-DRKAVIKNADMSEEMQQDAVDCATQALEKFNIEKDIAAFIKKEFD 214 +H ++ K+T DK+C + V+ A ++ + +EK + A +KK + Sbjct: 1689 IHRTQVKETDDKICFTMRPVVSCASGCTAVETKSKPYKFHCMEK----NEAAMKLKKRIE 1744 Query: 215 KKYNP 229 K NP Sbjct: 1745 KGANP 1749 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 23.0 bits (47), Expect = 1.8 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +3 Query: 222 TILPGIASWVVFWLVCDTRDSPLHLLL 302 +IL + SWV FWL D SP ++L Sbjct: 242 SILIVVISWVSFWLHMDA--SPPRIVL 266 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 21.8 bits (44), Expect = 4.1 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = +1 Query: 226 SYLALHRGSYFGSYVTHETRHFIYFYLGQVAIL 324 S L + YF ++VTH F G V I+ Sbjct: 156 SLLVVAEVCYFTAHVTHPRHRLCVFVAGVVFIV 188 >AB208107-1|BAE72139.1| 71|Apis mellifera Broad complex zinc finger domain-Z2 isoform protein. Length = 71 Score = 21.8 bits (44), Expect = 4.1 Identities = 6/17 (35%), Positives = 13/17 (76%) Frame = -1 Query: 160 ERLSCTVNSILLHLFAH 110 ER+ C+ NS++ H++ + Sbjct: 42 ERVYCSRNSLMTHIYTY 58 >U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodopsin protein. Length = 377 Score = 21.0 bits (42), Expect = 7.1 Identities = 6/15 (40%), Positives = 10/15 (66%) Frame = +2 Query: 224 NPTWHCIVGRILARM 268 NP WH I+G ++ + Sbjct: 48 NPMWHGILGFVIGML 62 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.0 bits (42), Expect = 7.1 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +3 Query: 237 IASWVVFWL 263 I SWV FWL Sbjct: 257 IVSWVSFWL 265 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.0 bits (42), Expect = 7.1 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +3 Query: 237 IASWVVFWL 263 I SWV FWL Sbjct: 257 IVSWVSFWL 265 >AY703752-1|AAU12748.1| 152|Apis mellifera long-wavelength rhodopsin protein. Length = 152 Score = 21.0 bits (42), Expect = 7.1 Identities = 6/15 (40%), Positives = 10/15 (66%) Frame = +2 Query: 224 NPTWHCIVGRILARM 268 NP WH I+G ++ + Sbjct: 14 NPMWHGILGFVIGML 28 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 20.6 bits (41), Expect = 9.4 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -1 Query: 244 DAMPGRIVFLVKFFL 200 DA+PGR+ LV L Sbjct: 226 DAIPGRVALLVTSML 240 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 20.6 bits (41), Expect = 9.4 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +3 Query: 222 TILPGIASWVVFWL 263 T L I SWV FW+ Sbjct: 255 TCLIVIMSWVSFWI 268 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 20.6 bits (41), Expect = 9.4 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +3 Query: 225 ILPGIASWVVFWL 263 +L + SWV FWL Sbjct: 225 VLLVVLSWVSFWL 237 >DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 20.6 bits (41), Expect = 9.4 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +3 Query: 237 IASWVVFWL 263 I SWV FWL Sbjct: 236 IISWVSFWL 244 >DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 20.6 bits (41), Expect = 9.4 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +3 Query: 237 IASWVVFWL 263 I SWV FWL Sbjct: 236 IISWVSFWL 244 >AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl subunit protein. Length = 365 Score = 20.6 bits (41), Expect = 9.4 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +3 Query: 237 IASWVVFWL 263 I SWV FWL Sbjct: 175 IISWVSFWL 183 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 133,382 Number of Sequences: 438 Number of extensions: 2659 Number of successful extensions: 14 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13618701 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -