BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0053 (548 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 26 0.71 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 23 6.6 AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. 23 8.8 AY146760-1|AAO12075.1| 313|Anopheles gambiae odorant-binding pr... 23 8.8 AF393487-1|AAL60412.1| 304|Anopheles gambiae odorant binding pr... 23 8.8 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 26.2 bits (55), Expect = 0.71 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +2 Query: 158 VQTTFDLHDNTEWQVQDKHTI 220 V T F H EW +DKH I Sbjct: 388 VSTMFSDHSPAEWPTEDKHEI 408 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 23.0 bits (47), Expect = 6.6 Identities = 6/20 (30%), Positives = 13/20 (65%) Frame = -1 Query: 68 QYVGRHRFGRNIWYWVILEP 9 +Y+ +HR +W++V +P Sbjct: 1157 RYIPKHRIQYKVWWFVTSQP 1176 >AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. Length = 1132 Score = 22.6 bits (46), Expect = 8.8 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +2 Query: 371 AESLEINIKNKMFCELFPEYVEEIEQQLKQ 460 AE L ++ CEL E E EQQ+++ Sbjct: 314 AEELYKKLRKHRLCELNREPTEREEQQMQK 343 >AY146760-1|AAO12075.1| 313|Anopheles gambiae odorant-binding protein AgamOBP31 protein. Length = 313 Score = 22.6 bits (46), Expect = 8.8 Identities = 14/41 (34%), Positives = 17/41 (41%), Gaps = 3/41 (7%) Frame = +1 Query: 205 RQTHDCASVLQTFIRTLEPCLVYFYDPYRSVE---FYVGED 318 + HDCA LQ L L Y + P + F VG D Sbjct: 35 QSVHDCAEYLQVPKHRLVQYLAYEFPPDEETKCLIFCVGTD 75 >AF393487-1|AAL60412.1| 304|Anopheles gambiae odorant binding protein 1 protein. Length = 304 Score = 22.6 bits (46), Expect = 8.8 Identities = 14/41 (34%), Positives = 17/41 (41%), Gaps = 3/41 (7%) Frame = +1 Query: 205 RQTHDCASVLQTFIRTLEPCLVYFYDPYRSVE---FYVGED 318 + HDCA LQ L L Y + P + F VG D Sbjct: 35 QSVHDCAEYLQVPKHRLVQYLAYEFPPDEETKCLIFCVGTD 75 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 629,388 Number of Sequences: 2352 Number of extensions: 13644 Number of successful extensions: 21 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 50881347 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -