BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0049 (429 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPB1A11.01 ||SPAPB24D3.11|membrane transporter|Schizosaccharom... 26 2.2 SPBC1604.15 |gpi16||pig-T |Schizosaccharomyces pombe|chr 2|||Manual 25 3.8 SPCC1322.14c |vtc4||vacuolar transporter chaperone |Schizosaccha... 24 8.7 >SPAPB1A11.01 ||SPAPB24D3.11|membrane transporter|Schizosaccharomyces pombe|chr 1|||Manual Length = 495 Score = 26.2 bits (55), Expect = 2.2 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = +2 Query: 23 PCNYVYKVFILNTILLFFRTLSCKY 97 P + ++ I+NTI++ F T+ C Y Sbjct: 30 PLTWPIRIRIINTIIISFMTMLCMY 54 >SPBC1604.15 |gpi16||pig-T |Schizosaccharomyces pombe|chr 2|||Manual Length = 545 Score = 25.4 bits (53), Expect = 3.8 Identities = 8/31 (25%), Positives = 17/31 (54%) Frame = +2 Query: 134 MNNPPNQSYWFVLREDXSNVILSTNNFVNQN 226 M N P+ YW L S ++ ++ N+++ + Sbjct: 121 MANDPSMKYWLKLTNQLSGLLCASLNYIDSS 151 >SPCC1322.14c |vtc4||vacuolar transporter chaperone |Schizosaccharomyces pombe|chr 3|||Manual Length = 721 Score = 24.2 bits (50), Expect = 8.7 Identities = 6/29 (20%), Positives = 21/29 (72%) Frame = +2 Query: 125 KMDMNNPPNQSYWFVLREDXSNVILSTNN 211 ++D +NPPN++ + +L + ++++ + ++ Sbjct: 85 RLDSDNPPNENDFAILETELTDIMATVHD 113 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,479,220 Number of Sequences: 5004 Number of extensions: 26054 Number of successful extensions: 42 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 42 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 42 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 154448264 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -