BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0048 (499 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 21 6.2 AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory recept... 21 6.2 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 21.0 bits (42), Expect = 6.2 Identities = 10/31 (32%), Positives = 14/31 (45%) Frame = -1 Query: 307 NSIFYNIYGSKYNIFSTTFLGLAGIPRRYSD 215 N I YNI SK+ G+ + +R D Sbjct: 349 NPILYNIISSKFRSGFFKLCGMKIVKKRRKD 379 >AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory receptor candidate 49 protein. Length = 418 Score = 21.0 bits (42), Expect = 6.2 Identities = 6/16 (37%), Positives = 10/16 (62%) Frame = +1 Query: 259 WKKCYIYSHKYCKKLN 306 W C++ SHK+ +N Sbjct: 396 WTFCHMVSHKWLNYIN 411 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 86,151 Number of Sequences: 336 Number of extensions: 1325 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11735024 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -