BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0047 (678 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF014219-1|ABJ91581.1| 647|Anopheles gambiae cation proton anti... 25 1.7 CR954257-9|CAJ14160.1| 573|Anopheles gambiae putative esterase ... 25 2.2 >EF014219-1|ABJ91581.1| 647|Anopheles gambiae cation proton antiporter protein. Length = 647 Score = 25.4 bits (53), Expect = 1.7 Identities = 16/56 (28%), Positives = 27/56 (48%) Frame = +1 Query: 340 NVKRRVQQAMRGKPKKKQLLSINDKALLNKPANERTEQEKNTYIELLAA*NVLSVI 507 NVK ++ A+ K ++ AL +NE +E+ Y EL+ +LS+I Sbjct: 509 NVKEKIFVAISWMSKATVQAALGPVALKTVMSNENRTEEEVHYAELVKMVCILSII 564 >CR954257-9|CAJ14160.1| 573|Anopheles gambiae putative esterase protein. Length = 573 Score = 25.0 bits (52), Expect = 2.2 Identities = 14/47 (29%), Positives = 20/47 (42%) Frame = -3 Query: 574 DSPTRAVVFEVRHCR*FLLYVIG*RLKHFKPPIIRYMYFSPVLFVRW 434 DSPT V C F Y + + +PP+ + +PV RW Sbjct: 40 DSPTGQVQGTTESCGLFCTYYSFKGIPYAEPPVGSLRFRNPVPRARW 86 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 635,005 Number of Sequences: 2352 Number of extensions: 11037 Number of successful extensions: 69 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 69 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 69 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68159265 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -