BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0047 (678 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z68012-3|CAA92017.1| 269|Caenorhabditis elegans Hypothetical pr... 28 7.0 AL117195-12|CAB60765.1| 425|Caenorhabditis elegans Hypothetical... 27 9.3 >Z68012-3|CAA92017.1| 269|Caenorhabditis elegans Hypothetical protein T24D5.3 protein. Length = 269 Score = 27.9 bits (59), Expect = 7.0 Identities = 13/49 (26%), Positives = 28/49 (57%) Frame = +1 Query: 298 HWLIEDSENYEGLENVKRRVQQAMRGKPKKKQLLSINDKALLNKPANER 444 +WL E E +E +EN++++ + M K ++ +++ K +L N+R Sbjct: 21 NWLYELDELFE-IENIQKKNAEYMLFKSSPQKKKNVDSKVVLKPDVNQR 68 >AL117195-12|CAB60765.1| 425|Caenorhabditis elegans Hypothetical protein Y57A10A.19 protein. Length = 425 Score = 27.5 bits (58), Expect = 9.3 Identities = 11/49 (22%), Positives = 28/49 (57%) Frame = +1 Query: 310 EDSENYEGLENVKRRVQQAMRGKPKKKQLLSINDKALLNKPANERTEQE 456 +D + E + +K ++ + + K+++LL+++DK +PA E++ Sbjct: 211 KDRKKKEKKQKLKEMEKRREKLRQKERELLAVSDKVKKEEPAESSDEED 259 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,194,093 Number of Sequences: 27780 Number of extensions: 269568 Number of successful extensions: 692 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 682 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 692 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1539654388 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -