BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0047 (678 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 23 2.0 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 21 8.2 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 21 8.2 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 23.4 bits (48), Expect = 2.0 Identities = 15/48 (31%), Positives = 22/48 (45%) Frame = +1 Query: 382 KKKQLLSINDKALLNKPANERTEQEKNTYIELLAA*NVLSVIQSRKEE 525 + K LL + A +NK + + +E E A VI SRKE+ Sbjct: 764 RNKALLPVIKPANVNKEQSPNSTKETTPKKERKTATTTQPVISSRKEQ 811 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 21.4 bits (43), Expect = 8.2 Identities = 10/39 (25%), Positives = 20/39 (51%) Frame = +1 Query: 304 LIEDSENYEGLENVKRRVQQAMRGKPKKKQLLSINDKAL 420 L+E+ +NY E V +Q G + Q+ ++ +K + Sbjct: 64 LVENLDNYNDKEAVNEFMQLLKHGMLPRGQVFTMMNKEM 102 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 21.4 bits (43), Expect = 8.2 Identities = 10/39 (25%), Positives = 20/39 (51%) Frame = +1 Query: 304 LIEDSENYEGLENVKRRVQQAMRGKPKKKQLLSINDKAL 420 L+E+ +NY E V +Q G + Q+ ++ +K + Sbjct: 64 LVENLDNYNDKEAVNEFMQLLKHGMLPRGQVFTMMNKEM 102 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,484 Number of Sequences: 438 Number of extensions: 3567 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20586735 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -