BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0045 (598 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBP16F5.03c |||phosphatidylinositol kinase |Schizosaccharomyces... 27 1.6 SPAC458.07 |tfa1|SPAPYUG7.01|transcription factor TFIIE alpha su... 26 4.8 SPAPB1A10.12c |alo1||D-arabinono-1,4-lactone oxidase|Schizosacch... 25 6.3 >SPBP16F5.03c |||phosphatidylinositol kinase |Schizosaccharomyces pombe|chr 2|||Manual Length = 3699 Score = 27.5 bits (58), Expect = 1.6 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = -2 Query: 126 NSLQRESKGHSRSSQYRSLNKDDVFY 49 N+ +ES+ + + Y SLN+DD+FY Sbjct: 2577 NAKVQESRADAVAELYASLNEDDMFY 2602 >SPAC458.07 |tfa1|SPAPYUG7.01|transcription factor TFIIE alpha subunit Tfa1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 448 Score = 25.8 bits (54), Expect = 4.8 Identities = 20/64 (31%), Positives = 30/64 (46%) Frame = +2 Query: 269 HTTEFKADFLSQFDYKTWKNNRRLKPRLWRGCNVADRIAKVHVDEFLDSDDSSKEVFQSL 448 HTT F DF S D W+ ++ +K R N D +K +V F + SS +V + Sbjct: 97 HTTYFYIDFCSTIDSIKWRMHQLVKTVEDRMRNDFD--SKGYVCPFCNKKFSSLDVLSLV 154 Query: 449 LDYG 460 + G Sbjct: 155 TNEG 158 >SPAPB1A10.12c |alo1||D-arabinono-1,4-lactone oxidase|Schizosaccharomyces pombe|chr 1|||Manual Length = 461 Score = 25.4 bits (53), Expect = 6.3 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = +3 Query: 111 PFEDCWLRDHCRCSQCY 161 P ++CWL C+ CY Sbjct: 366 PEDECWLSTDCKVPTCY 382 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,356,555 Number of Sequences: 5004 Number of extensions: 46607 Number of successful extensions: 140 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 134 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 140 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 260219058 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -