BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0045 (598 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0633 + 21402847-21402862,21403143-21404975,21405052-214051... 28 6.5 03_05_0049 - 20277234-20277251,20277670-20277795,20278085-202781... 28 6.5 12_01_0616 - 5076126-5076371,5077386-5077613,5079356-5079859 27 8.6 >12_02_0633 + 21402847-21402862,21403143-21404975,21405052-21405170, 21405288-21405722 Length = 800 Score = 27.9 bits (59), Expect = 6.5 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = +2 Query: 416 DDSSKEVFQSLLDYGVAFITGVQP-SAEATETCAKL*EEFNT 538 D KEV + D FITGV P S+E + CAK ++ T Sbjct: 692 DPIEKEVDDVVADVDNEFITGVVPSSSEMDQQCAKESQQHTT 733 >03_05_0049 - 20277234-20277251,20277670-20277795,20278085-20278153, 20278233-20278280,20278413-20278494,20278583-20278662, 20278764-20278835,20278912-20279006,20280396-20280477, 20280604-20280963 Length = 343 Score = 27.9 bits (59), Expect = 6.5 Identities = 15/53 (28%), Positives = 24/53 (45%) Frame = +2 Query: 308 DYKTWKNNRRLKPRLWRGCNVADRIAKVHVDEFLDSDDSSKEVFQSLLDYGVA 466 D + W+ R++P L R A R+ + D + SDD Q+ D +A Sbjct: 279 DERNWRKGLRVRPVLRRSPKSAMRLKRPDFDHLMISDDDHSPQSQASSDSPMA 331 >12_01_0616 - 5076126-5076371,5077386-5077613,5079356-5079859 Length = 325 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = -2 Query: 117 QRESKGHSRSSQYRSLNKDDVFYFFRTVFIESDTEF 10 + ++ G S SQ R +DDV R ++ +D+EF Sbjct: 206 RHQAAGSSSPSQQRREEEDDVTAAIRAAYLTTDSEF 241 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,364,017 Number of Sequences: 37544 Number of extensions: 267871 Number of successful extensions: 675 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 660 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 675 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1423789920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -