BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0045 (598 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF487536-1|AAL93297.1| 504|Anopheles gambiae cytochrome P450 CY... 26 0.80 AJ297933-1|CAC35453.2| 392|Anopheles gambiae Ag9 protein protein. 24 4.3 AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. 23 5.7 AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbona... 23 5.7 AF042732-3|AAC18058.1| 496|Anopheles gambiae diphenol oxidase-A... 23 9.9 >AF487536-1|AAL93297.1| 504|Anopheles gambiae cytochrome P450 CYP6Y1 protein. Length = 504 Score = 26.2 bits (55), Expect = 0.80 Identities = 15/45 (33%), Positives = 19/45 (42%) Frame = -1 Query: 214 FESGSSKMCLALWNVFA**HCEHLQWSLSQQSSKGIEGPFSKFTV 80 F SG KM L L CEHL SL + S++T+ Sbjct: 138 FTSGRIKMTLPLITQVCERFCEHLNESLQSSDEIEVHDLLSRYTI 182 >AJ297933-1|CAC35453.2| 392|Anopheles gambiae Ag9 protein protein. Length = 392 Score = 23.8 bits (49), Expect = 4.3 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = -3 Query: 143 AMVSEPTVFKGNRRAILEVHST-VLSTKMTFSIFFALFSLNPT 18 A+ S P+ GNR L+VH T VL+ F + S +P+ Sbjct: 50 ALRSPPSYRIGNRTIRLQVHFTWVLAALCAFLLLVLYISSSPS 92 >AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. Length = 897 Score = 23.4 bits (48), Expect = 5.7 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +2 Query: 263 DKHTTEFKADFLSQFDYKTWKNNRRLK 343 D+ E +S+ D WK N RLK Sbjct: 733 DERELELLISGISKIDVNDWKANTRLK 759 >AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbonate anion exchanger protein. Length = 1102 Score = 23.4 bits (48), Expect = 5.7 Identities = 15/44 (34%), Positives = 27/44 (61%), Gaps = 1/44 (2%) Frame = -1 Query: 343 LQSAIVF-PSFIIELRQKVRFEFCSVLIVPLIVRLFLSNCNVSI 215 L S ++F ++II + K +F + L P +VR F+S+ +V+I Sbjct: 726 LMSIVLFLGTYIISVILK---DFKNALFFPAVVRQFISDFSVTI 766 >AF042732-3|AAC18058.1| 496|Anopheles gambiae diphenol oxidase-A2 protein. Length = 496 Score = 22.6 bits (46), Expect = 9.9 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +1 Query: 199 NCPIRRYLHYN 231 NC +R YLHY+ Sbjct: 215 NCLLRNYLHYS 225 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 593,004 Number of Sequences: 2352 Number of extensions: 12087 Number of successful extensions: 32 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 57609459 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -