BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0041 (548 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY334011-1|AAR01136.1| 188|Anopheles gambiae beta-tubulin protein. 63 5e-12 AY334010-1|AAR01135.1| 188|Anopheles gambiae beta-tubulin protein. 63 5e-12 AY334009-1|AAR01134.1| 188|Anopheles gambiae beta-tubulin protein. 63 5e-12 AY334008-1|AAR01133.1| 188|Anopheles gambiae beta-tubulin protein. 63 5e-12 U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles ... 27 0.54 AY176048-1|AAO19579.1| 521|Anopheles gambiae cytochrome P450 CY... 25 2.2 AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P... 24 2.9 AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. 24 3.8 AJ441131-2|CAD29631.1| 208|Anopheles gambiae hypothetical prote... 24 3.8 AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcript... 24 3.8 AJ439398-1|CAD28124.1| 208|Anopheles gambiae hypothetical prote... 23 5.0 AF117749-1|AAD38335.1| 372|Anopheles gambiae serine protease 14... 23 5.0 AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcript... 23 5.0 AY146748-1|AAO12063.1| 279|Anopheles gambiae odorant-binding pr... 23 6.6 >AY334011-1|AAR01136.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 63.3 bits (147), Expect = 5e-12 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 381 HYTEGAELVDSVLDVVRKEAEGCDCLQGFQ 470 HYTEGAELVD+VLDVVRKE E CDCLQGFQ Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQ 30 Score = 30.3 bits (65), Expect = 0.044 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 509 GTLLISKIREEYP 547 GTLLISKIREEYP Sbjct: 44 GTLLISKIREEYP 56 >AY334010-1|AAR01135.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 63.3 bits (147), Expect = 5e-12 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 381 HYTEGAELVDSVLDVVRKEAEGCDCLQGFQ 470 HYTEGAELVD+VLDVVRKE E CDCLQGFQ Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQ 30 Score = 30.3 bits (65), Expect = 0.044 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 509 GTLLISKIREEYP 547 GTLLISKIREEYP Sbjct: 44 GTLLISKIREEYP 56 >AY334009-1|AAR01134.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 63.3 bits (147), Expect = 5e-12 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 381 HYTEGAELVDSVLDVVRKEAEGCDCLQGFQ 470 HYTEGAELVD+VLDVVRKE E CDCLQGFQ Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQ 30 Score = 30.3 bits (65), Expect = 0.044 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 509 GTLLISKIREEYP 547 GTLLISKIREEYP Sbjct: 44 GTLLISKIREEYP 56 >AY334008-1|AAR01133.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 63.3 bits (147), Expect = 5e-12 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 381 HYTEGAELVDSVLDVVRKEAEGCDCLQGFQ 470 HYTEGAELVD+VLDVVRKE E CDCLQGFQ Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQ 30 Score = 30.3 bits (65), Expect = 0.044 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 509 GTLLISKIREEYP 547 GTLLISKIREEYP Sbjct: 44 GTLLISKIREEYP 56 >U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles gambiae putativetubulin alpha chain mRNA, complete cds. ). Length = 91 Score = 26.6 bits (56), Expect = 0.54 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +1 Query: 70 MREIVHIQAGQCGNQIGAKFWE 135 MRE + + GQ G QIG W+ Sbjct: 1 MRECISVHVGQAGVQIGNPCWD 22 >AY176048-1|AAO19579.1| 521|Anopheles gambiae cytochrome P450 CYP12F4 protein. Length = 521 Score = 24.6 bits (51), Expect = 2.2 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +2 Query: 278 WNHGLRPFRAVWANLPTGQLRLR 346 WN+G +RA N+P L+ + Sbjct: 493 WNYGELKYRATLVNIPANDLKFQ 515 >AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P450 reductase protein. Length = 679 Score = 24.2 bits (50), Expect = 2.9 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +1 Query: 124 KFWEVISDEHGIDATG 171 KFW + D GI++TG Sbjct: 225 KFWPTVCDYFGIESTG 240 >AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. Length = 1187 Score = 23.8 bits (49), Expect = 3.8 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -2 Query: 346 PKTKLSGRKICPNGPERTESMVPGSRSTITA 254 P K+SGRKI P+ E +V G + TA Sbjct: 575 PLNKISGRKIDPSVARFAEELV-GKENVTTA 604 >AJ441131-2|CAD29631.1| 208|Anopheles gambiae hypothetical protein protein. Length = 208 Score = 23.8 bits (49), Expect = 3.8 Identities = 16/56 (28%), Positives = 25/56 (44%), Gaps = 4/56 (7%) Frame = +3 Query: 249 PAAVMVDLEPGTMDSVRSGPFGQIF----RPDNFVFGQSGAGNNWAKGHYTEGAEL 404 P+ + L G+ +S FG F RP N+ + ++ NN + H T A L Sbjct: 107 PSLAITGLSIGSSNSSFLRQFGPQFTGTKRPQNWFYSRNNNNNNNNEHHNTYNARL 162 >AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcriptase protein. Length = 1009 Score = 23.8 bits (49), Expect = 3.8 Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 3/32 (9%) Frame = -1 Query: 353 RLSEDEVVR-SEDLP--KRPGTDGVHGSRLKV 267 R++ DE++ + LP K PG DG+ LKV Sbjct: 396 RITNDEILAVARRLPNKKAPGPDGIPNEALKV 427 >AJ439398-1|CAD28124.1| 208|Anopheles gambiae hypothetical protein protein. Length = 208 Score = 23.4 bits (48), Expect = 5.0 Identities = 16/56 (28%), Positives = 25/56 (44%), Gaps = 4/56 (7%) Frame = +3 Query: 249 PAAVMVDLEPGTMDSVRSGPFGQIF----RPDNFVFGQSGAGNNWAKGHYTEGAEL 404 P+ + L G+ +S FG F RP N+ + ++ NN + H T A L Sbjct: 107 PSLAITGLSIGSSNSRFLRQFGPQFTGTNRPQNWFYSRNNNNNNNNEHHNTYNARL 162 >AF117749-1|AAD38335.1| 372|Anopheles gambiae serine protease 14D2 protein. Length = 372 Score = 23.4 bits (48), Expect = 5.0 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +3 Query: 342 FGQSGAGNNWAKGHYTEGAELVDSVLDVV 428 FG G + G YT +E +D VLD + Sbjct: 343 FGLEQCGTDGVPGVYTRMSEYMDWVLDTM 371 >AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcriptase protein. Length = 1209 Score = 23.4 bits (48), Expect = 5.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 501 IQYLLPENELAENPADNRSLLLLF*LHPV 415 + Y LP+++ +NPA R L L L+ V Sbjct: 518 VTYFLPKDQNTKNPAKYRPLTCLSNLNKV 546 >AY146748-1|AAO12063.1| 279|Anopheles gambiae odorant-binding protein AgamOBP41 protein. Length = 279 Score = 23.0 bits (47), Expect = 6.6 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +1 Query: 166 TGAYSGDSDLQLERINVYYNE 228 TG YS + ++R+N Y E Sbjct: 203 TGVYSDREGVSIDRLNAQYGE 223 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 591,870 Number of Sequences: 2352 Number of extensions: 12643 Number of successful extensions: 41 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 37 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 41 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 50881347 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -