BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0041 (548 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 24 0.88 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 24 0.88 AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 24 0.88 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 23 1.5 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 2.7 DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholi... 22 4.7 DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholi... 22 4.7 EF127800-1|ABL67937.1| 461|Apis mellifera nicotinic acetylcholi... 21 6.2 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 21 6.2 AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 21 8.2 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 24.2 bits (50), Expect = 0.88 Identities = 7/20 (35%), Positives = 14/20 (70%) Frame = +3 Query: 405 VDSVLDVVRKEAEGCDCLQG 464 +DS+++++R + CD L G Sbjct: 106 IDSIINIIRVRVDACDRLWG 125 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 24.2 bits (50), Expect = 0.88 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = -1 Query: 314 PKRPGTDGVHGSRLKVHH 261 P+ PGT ++ ++LK HH Sbjct: 139 PREPGTPRINFTKLKRHH 156 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 24.2 bits (50), Expect = 0.88 Identities = 12/50 (24%), Positives = 21/50 (42%) Frame = -1 Query: 419 QYRINQFSPLCVMSFRPVIPRPRLSEDEVVRSEDLPKRPGTDGVHGSRLK 270 Q+ SP+ S+ P P ++ DE+ + L +DG + K Sbjct: 127 QHNNGYASPMSTSSYDPYSPNSKIGRDELSQPGSLNGYGSSDGCDARKKK 176 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 23.4 bits (48), Expect = 1.5 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +1 Query: 184 DSDLQLERINVYYNEASGGKYVPRL*W 264 D+ L+ I Y N+ GG++V L W Sbjct: 72 DARLKFSNIAPYLNQIYGGQFVRDLIW 98 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.6 bits (46), Expect = 2.7 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +2 Query: 146 TSTALTPRVLTAATPTCSLNASMST 220 T+T T T TP + NAS +T Sbjct: 664 TTTTTTTTTTTTTTPNTTQNASATT 688 >DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 21.8 bits (44), Expect = 4.7 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = -1 Query: 302 GTDGVHGSRLKVHHHSRGTYLPP 234 G DG + + + V H+ Y+PP Sbjct: 150 GFDGTYQTNVVVTHNGSCLYVPP 172 >DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 21.8 bits (44), Expect = 4.7 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = -1 Query: 302 GTDGVHGSRLKVHHHSRGTYLPP 234 G DG + + + V H+ Y+PP Sbjct: 150 GFDGTYQTNVVVTHNGSCLYVPP 172 >EF127800-1|ABL67937.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 1 protein. Length = 461 Score = 21.4 bits (43), Expect = 6.2 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = -1 Query: 302 GTDGVHGSRLKVHHHSRGTYLPP 234 G DG + + + V H+ Y+PP Sbjct: 82 GFDGTYQTSVVVTHNGSCLYVPP 104 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.4 bits (43), Expect = 6.2 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = -3 Query: 252 RDVLAP*SFVIVDIDAFKLQVGVAAVSTRGVNAVLV 145 RD++ +++ K VG V T+G NAV V Sbjct: 117 RDLIVDRDVPTWEVNILKSIVGQLQVDTQGENAVKV 152 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 21.0 bits (42), Expect = 8.2 Identities = 11/42 (26%), Positives = 19/42 (45%) Frame = -3 Query: 411 NQPVQPPLCNVLSPSYSPPQTVRRRSCPVGRFAQTARNGRSP 286 ++PV+PP P + P+ + +S P + N SP Sbjct: 335 SEPVEPPRRKNNCPLHCKPELGQSQSSPKFVARREESNSSSP 376 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,466 Number of Sequences: 438 Number of extensions: 3509 Number of successful extensions: 15 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15704448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -