BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0035 (648 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB208913-1|BAD92150.1| 1515|Homo sapiens integrin beta 4 isoform... 33 1.2 X98507-1|CAA67131.1| 1028|Homo sapiens myosin I beta protein. 32 1.5 BC068013-1|AAH68013.1| 1028|Homo sapiens myosin IC protein. 32 1.5 BC044891-1|AAH44891.2| 1028|Homo sapiens MYO1C protein protein. 32 1.5 AB210015-1|BAE06097.1| 1097|Homo sapiens MYO1C variant protein p... 32 1.5 BC117697-1|AAI17698.1| 1690|Homo sapiens COL11A1 protein protein. 31 4.7 >AB208913-1|BAD92150.1| 1515|Homo sapiens integrin beta 4 isoform 3 precursor variant protein. Length = 1515 Score = 32.7 bits (71), Expect = 1.2 Identities = 22/72 (30%), Positives = 32/72 (44%), Gaps = 1/72 (1%) Frame = +3 Query: 435 GQQNEPNPAVVGMSGIQQTP-VGGEPRVRRLLEYLTAEEQRMAAILAAVGLSTTPRRRCR 611 G + P +G QQ P + G R R + + + A L +V LS T RC+ Sbjct: 4 GAEGASPPRGRSRTGAQQQPRLAGRGRKRMAGPRPSPWARLLLAALISVSLSGTLANRCK 63 Query: 612 TAPDESAPQCTR 647 AP +S +C R Sbjct: 64 KAPVKSCTECVR 75 >X98507-1|CAA67131.1| 1028|Homo sapiens myosin I beta protein. Length = 1028 Score = 32.3 bits (70), Expect = 1.5 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = +1 Query: 97 VLPALSAEDVSYQACVDKYSRKGYQP 174 VL AL +E + Y V KY RKGY+P Sbjct: 875 VLQALGSEPIQYAVPVVKYDRKGYKP 900 >BC068013-1|AAH68013.1| 1028|Homo sapiens myosin IC protein. Length = 1028 Score = 32.3 bits (70), Expect = 1.5 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = +1 Query: 97 VLPALSAEDVSYQACVDKYSRKGYQP 174 VL AL +E + Y V KY RKGY+P Sbjct: 875 VLQALGSEPIQYAVPVVKYDRKGYKP 900 >BC044891-1|AAH44891.2| 1028|Homo sapiens MYO1C protein protein. Length = 1028 Score = 32.3 bits (70), Expect = 1.5 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = +1 Query: 97 VLPALSAEDVSYQACVDKYSRKGYQP 174 VL AL +E + Y V KY RKGY+P Sbjct: 875 VLQALGSEPIQYAVPVVKYDRKGYKP 900 >AB210015-1|BAE06097.1| 1097|Homo sapiens MYO1C variant protein protein. Length = 1097 Score = 32.3 bits (70), Expect = 1.5 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = +1 Query: 97 VLPALSAEDVSYQACVDKYSRKGYQP 174 VL AL +E + Y V KY RKGY+P Sbjct: 944 VLQALGSEPIQYAVPVVKYDRKGYKP 969 >BC117697-1|AAI17698.1| 1690|Homo sapiens COL11A1 protein protein. Length = 1690 Score = 30.7 bits (66), Expect = 4.7 Identities = 23/66 (34%), Positives = 29/66 (43%), Gaps = 1/66 (1%) Frame = +3 Query: 300 EYIEDENV-EFPTCCARLRCVVEVNGERIVQTRGQPGELFPDKPWKGQQNEPNPAVVGMS 476 EY E E+V E PT E+NG +GQ GE +P + P PA G + Sbjct: 277 EYKEAESVTEGPTVTEETIAQTEINGHGAYGEKGQKGEPAVVEPGMLVEGPPGPA--GPA 334 Query: 477 GIQQTP 494 GI P Sbjct: 335 GIMGPP 340 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 109,278,764 Number of Sequences: 237096 Number of extensions: 2781156 Number of successful extensions: 11035 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 10636 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11031 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7197658880 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -