BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0034 (598 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81120-7|CAB03343.2| 274|Caenorhabditis elegans Hypothetical pr... 29 3.3 AC006618-3|AAK68251.3| 960|Caenorhabditis elegans Patched relat... 27 7.7 >Z81120-7|CAB03343.2| 274|Caenorhabditis elegans Hypothetical protein T12D8.3 protein. Length = 274 Score = 28.7 bits (61), Expect = 3.3 Identities = 15/49 (30%), Positives = 22/49 (44%) Frame = -3 Query: 464 AWTLTSLPSRSLNLNLACWVFALLCTSTVPSKSITFTNGVWAKKTNLVG 318 +W S SRS + C + A L TS P +G+W K + +G Sbjct: 85 SWLANSQMSRSRAMEAYCELMAQLDTSWDPDAETVKKSGLWEKMPSTMG 133 >AC006618-3|AAK68251.3| 960|Caenorhabditis elegans Patched related family protein 4 protein. Length = 960 Score = 27.5 bits (58), Expect = 7.7 Identities = 14/41 (34%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = -2 Query: 258 DYDSRI-YRFGSGTLKTAFDLMTTSLSNLGWKNPISAAIAS 139 DY I YR+ KTA + + +L+++GW P++ A+ S Sbjct: 853 DYSVHICYRYHRSEYKTAQEKVADTLASVGW--PVTQAVCS 891 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,738,351 Number of Sequences: 27780 Number of extensions: 280662 Number of successful extensions: 704 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 683 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 704 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1268802960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -