BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0033 (698 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 25 0.52 DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 25 0.91 AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 23 2.8 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 22 6.4 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 6.4 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 25.4 bits (53), Expect = 0.52 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = -1 Query: 194 FWRRTFAASARVQLKLDTVELLATSAAQSQ 105 FW + AA ARV L + ++ L+T A+SQ Sbjct: 266 FWIKPEAAPARVTLGVTSLLTLSTQHAKSQ 295 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 24.6 bits (51), Expect = 0.91 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -1 Query: 194 FWRRTFAASARVQLKLDTVELLATSAAQSQ 105 FW + A ARV L + ++ LAT QSQ Sbjct: 235 FWIKPEAIPARVTLGVTSLLTLATQNTQSQ 264 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 23.0 bits (47), Expect = 2.8 Identities = 7/30 (23%), Positives = 15/30 (50%) Frame = -1 Query: 497 VYQCKKAFRLNIATNCSDTLLNMVCMAVVL 408 +Y CK+ + AT+C ++ C ++ Sbjct: 171 LYNCKRTATITAATDCQLWAIDRQCFQTIM 200 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 21.8 bits (44), Expect = 6.4 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = -1 Query: 194 FWRRTFAASARVQLKLDTVELLAT 123 FW A SARV L + TV + T Sbjct: 263 FWINHEATSARVALGITTVLTMTT 286 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.8 bits (44), Expect = 6.4 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -3 Query: 240 TVKYLPCRGSHATIMFLASNICSVSSGT 157 T KY+ +A + LAS I S S+GT Sbjct: 2 TAKYVFTTLINAAFLCLASTILSESAGT 29 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,253 Number of Sequences: 438 Number of extensions: 3763 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -