BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0032 (648 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory recept... 23 2.9 DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory pro... 22 3.8 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 22 5.0 AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH trans... 21 6.6 AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 21 8.7 >AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory receptor candidate 33 protein. Length = 321 Score = 22.6 bits (46), Expect = 2.9 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -2 Query: 89 RARPLLLQNRTKLILHGNTIQ 27 R + L QNR + + HG T+Q Sbjct: 163 RLKAQLWQNRYETVAHGMTVQ 183 >DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory protein 6 protein. Length = 251 Score = 22.2 bits (45), Expect = 3.8 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +1 Query: 472 LXANCXRRTESWKTGAVLNLKR 537 L NC + TE +T A ++KR Sbjct: 68 LQTNCAKCTEKQRTAAYRSIKR 89 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 21.8 bits (44), Expect = 5.0 Identities = 14/51 (27%), Positives = 21/51 (41%) Frame = +2 Query: 365 RVXTMSLPRASAPPGATPQRDYRPVPRHQF*CQTRD*XRTVTGELKAGKQV 517 RV +++ R PPG R P + T D + GE+ K+V Sbjct: 820 RVESLTPERKMEPPGVPLNSTPRSTPDKREKSPTSDKAQEADGEVVVKKEV 870 >AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH transcription factor protein. Length = 193 Score = 21.4 bits (43), Expect = 6.6 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = -2 Query: 530 KLSTAPVFQLSVRLXQFAXNL*SDIKIGDVELVDNL 423 KLS +L+ R F ++ S+ DV+L+ N+ Sbjct: 130 KLSKIQTLKLAARYIDFLYHVLSNENALDVDLIGNV 165 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 21.0 bits (42), Expect = 8.7 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = -3 Query: 271 RVLXISFRXSKKNSSSCASLPLTEARTRXMRSMYFPTQ 158 R+L + F + S S+P T R M S FP + Sbjct: 320 RMLDMGFLGDVEEMLSHQSMPATGERQTLMFSATFPEE 357 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 116,214 Number of Sequences: 336 Number of extensions: 1866 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16656800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -