BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0032 (648 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC14C4.10c |||Nudix family hydrolase|Schizosaccharomyces pombe... 27 2.3 SPAC9G1.06c |cyk3||cytokinesis protein Cyk3|Schizosaccharomyces ... 25 7.1 >SPAC14C4.10c |||Nudix family hydrolase|Schizosaccharomyces pombe|chr 1|||Manual Length = 329 Score = 27.1 bits (57), Expect = 2.3 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = -1 Query: 582 ANXSVLVAFKESIDGSLQVKYGTCFPAFSSPVTVRXQ 472 A+ +V++AFKES D S K+ C P S P + Q Sbjct: 30 ASVAVIIAFKESQDFS-NPKWPQCIPITSVPYVLLIQ 65 >SPAC9G1.06c |cyk3||cytokinesis protein Cyk3|Schizosaccharomyces pombe|chr 1|||Manual Length = 886 Score = 25.4 bits (53), Expect = 7.1 Identities = 11/31 (35%), Positives = 14/31 (45%) Frame = +2 Query: 353 KYGDRVXTMSLPRASAPPGATPQRDYRPVPR 445 K D S PR S PG +P + R + R Sbjct: 247 KLDDSTDNSSKPRTSLQPGESPMKSSRDISR 277 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,070,161 Number of Sequences: 5004 Number of extensions: 31780 Number of successful extensions: 101 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 76 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 101 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 291768710 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -