BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0028 (598 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC130630-1|AAI30631.1| 830|Homo sapiens PHC2 protein protein. 31 4.1 AL513327-5|CAI13957.1| 858|Homo sapiens polyhomeotic homolog 2 ... 31 4.1 AL513327-4|CAI13956.1| 464|Homo sapiens polyhomeotic homolog 2 ... 31 4.1 AK024260-1|BAB14863.1| 126|Homo sapiens protein ( Homo sapiens ... 31 4.1 AJ419231-1|CAD11673.1| 858|Homo sapiens polyhomeotic 2 protein. 31 4.1 >BC130630-1|AAI30631.1| 830|Homo sapiens PHC2 protein protein. Length = 830 Score = 30.7 bits (66), Expect = 4.1 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -3 Query: 161 EPGSTPRCPSGTPSMSPQKGSPASQPYTLXR 69 +PG + +C TP PQ G P P+T R Sbjct: 387 KPGGSQQCHPPTPDTGPQNGHPEGVPHTPQR 417 >AL513327-5|CAI13957.1| 858|Homo sapiens polyhomeotic homolog 2 (Drosophila) protein. Length = 858 Score = 30.7 bits (66), Expect = 4.1 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -3 Query: 161 EPGSTPRCPSGTPSMSPQKGSPASQPYTLXR 69 +PG + +C TP PQ G P P+T R Sbjct: 416 KPGGSQQCHPPTPDTGPQNGHPEGVPHTPQR 446 >AL513327-4|CAI13956.1| 464|Homo sapiens polyhomeotic homolog 2 (Drosophila) protein. Length = 464 Score = 30.7 bits (66), Expect = 4.1 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -3 Query: 161 EPGSTPRCPSGTPSMSPQKGSPASQPYTLXR 69 +PG + +C TP PQ G P P+T R Sbjct: 21 KPGGSQQCHPPTPDTGPQNGHPEGVPHTPQR 51 >AK024260-1|BAB14863.1| 126|Homo sapiens protein ( Homo sapiens cDNA FLJ14198 fis, clone NT2RP3002512. ). Length = 126 Score = 30.7 bits (66), Expect = 4.1 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = +1 Query: 112 GDIDGVPLGQRGVLPGSTQINRKCFREGESRRAPSAGPML 231 G++ V G+R +LP Q+ C +EG SRR G +L Sbjct: 18 GNVTVVQKGERDILPNGQQV-LVCSQEGSSRRCGGQGDLL 56 >AJ419231-1|CAD11673.1| 858|Homo sapiens polyhomeotic 2 protein. Length = 858 Score = 30.7 bits (66), Expect = 4.1 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -3 Query: 161 EPGSTPRCPSGTPSMSPQKGSPASQPYTLXR 69 +PG + +C TP PQ G P P+T R Sbjct: 416 KPGGSQQCHPPTPDTGPQNGHPEGVPHTPQR 446 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 88,336,242 Number of Sequences: 237096 Number of extensions: 1862787 Number of successful extensions: 8969 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8677 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8967 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 6324506272 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -