BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0027 (429 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_49081| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.9 SB_22475| Best HMM Match : Peptidase_A17 (HMM E-Value=3e-11) 27 8.7 >SB_49081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 28.3 bits (60), Expect = 2.9 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = -1 Query: 192 DAVTDVPAHFFNFLEDLPPGLGSSTGHAQSQHQSED 85 D + D P H + L+ L GLG + GH+ S Q+ D Sbjct: 113 DGLGDTPGHSDSHLQTLD-GLGDTPGHSDSHPQTLD 147 >SB_22475| Best HMM Match : Peptidase_A17 (HMM E-Value=3e-11) Length = 646 Score = 26.6 bits (56), Expect = 8.7 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = -2 Query: 173 LPIFSIFLKIFHLGSGAALVMLKASTRAKT 84 L I S+FL I LG+G+ LV+LK +T Sbjct: 26 LTIVSLFLVISVLGNGSILVLLKRFKSLRT 55 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,776,406 Number of Sequences: 59808 Number of extensions: 219480 Number of successful extensions: 393 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 379 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 392 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 826502419 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -