BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0022 (598 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC19G12.01c |cut20|lid1, apc4, SPAPJ698.04c|anaphase-promoting... 25 8.4 >SPAC19G12.01c |cut20|lid1, apc4, SPAPJ698.04c|anaphase-promoting complex subunit Apc4|Schizosaccharomyces pombe|chr 1|||Manual Length = 719 Score = 25.0 bits (52), Expect = 8.4 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -2 Query: 402 IIFRTGRDRSIASLYFPANENDYTSLVQTLLMHLR 298 +I + G + S+ +LY P +ND S+V M R Sbjct: 230 LICKGGTNISLKTLYMPLLKNDLGSIVDIATMSTR 264 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,325,756 Number of Sequences: 5004 Number of extensions: 41149 Number of successful extensions: 76 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 73 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 76 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 260219058 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -