BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0022 (598 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcript... 25 1.4 AY330181-1|AAQ16287.1| 156|Anopheles gambiae odorant-binding pr... 25 2.5 AJ515150-1|CAD56157.2| 737|Anopheles gambiae acetylcholinestera... 23 5.7 AJ515149-1|CAD56156.1| 737|Anopheles gambiae acetylcholinestera... 23 5.7 AJ488492-1|CAD32684.2| 623|Anopheles gambiae acetylcholinestera... 23 5.7 AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcript... 23 9.9 >AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 25.4 bits (53), Expect = 1.4 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = -2 Query: 411 RTQIIFRTGRDRSIASLYFPANENDYTSLVQTLLMHLRGS 292 R + + G+ A L A EN+ Q +L HLRGS Sbjct: 353 RLEKAIKVGKRAEFAKLIDIAEENELGVGYQVVLSHLRGS 392 >AY330181-1|AAQ16287.1| 156|Anopheles gambiae odorant-binding protein AgamOBP55 protein. Length = 156 Score = 24.6 bits (51), Expect = 2.5 Identities = 11/28 (39%), Positives = 12/28 (42%) Frame = +3 Query: 75 RTVLWYVVQTTVKKIHXIQPTTCCPXNH 158 RTVLW V VK + CC H Sbjct: 8 RTVLWVTVIVLVKVMVKSDAQVCCMVEH 35 >AJ515150-1|CAD56157.2| 737|Anopheles gambiae acetylcholinesterase protein. Length = 737 Score = 23.4 bits (48), Expect = 5.7 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -1 Query: 337 LHKLSANSFDAFERLLTHSG 278 LH LSA S D F+R + SG Sbjct: 368 LHLLSALSRDLFQRAILQSG 387 >AJ515149-1|CAD56156.1| 737|Anopheles gambiae acetylcholinesterase protein. Length = 737 Score = 23.4 bits (48), Expect = 5.7 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -1 Query: 337 LHKLSANSFDAFERLLTHSG 278 LH LSA S D F+R + SG Sbjct: 368 LHLLSALSRDLFQRAILQSG 387 >AJ488492-1|CAD32684.2| 623|Anopheles gambiae acetylcholinesterase protein. Length = 623 Score = 23.4 bits (48), Expect = 5.7 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -1 Query: 337 LHKLSANSFDAFERLLTHSG 278 LH LSA S D F+R + SG Sbjct: 254 LHLLSALSRDLFQRAILQSG 273 >AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 22.6 bits (46), Expect = 9.9 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = -2 Query: 390 TGRDRSIASLYFPANENDYTSLVQTLLMHLRGS 292 TG+ + N N Y S Q + HLRGS Sbjct: 358 TGKGQLFQQQIDEVNANVYGSGYQVVTSHLRGS 390 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 598,972 Number of Sequences: 2352 Number of extensions: 10749 Number of successful extensions: 19 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 57609459 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -