BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0020 (598 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A2E1R1 Cluster: Ankyrin repeat protein, putative; n=1; ... 35 1.3 UniRef50_A0BLV7 Cluster: Chromosome undetermined scaffold_115, w... 32 8.9 >UniRef50_A2E1R1 Cluster: Ankyrin repeat protein, putative; n=1; Trichomonas vaginalis G3|Rep: Ankyrin repeat protein, putative - Trichomonas vaginalis G3 Length = 503 Score = 35.1 bits (77), Expect = 1.3 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = +3 Query: 462 YNVKTALTECKKYNNYHEWFIYI 530 YN+K L +C KYNNY +F+Y+ Sbjct: 220 YNLKIDLNQCCKYNNYEAFFVYL 242 >UniRef50_A0BLV7 Cluster: Chromosome undetermined scaffold_115, whole genome shotgun sequence; n=3; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_115, whole genome shotgun sequence - Paramecium tetraurelia Length = 2265 Score = 32.3 bits (70), Expect = 8.9 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = +3 Query: 450 VMFYYNVKTALTECKKYNNYHEWFIYIL*IHTKHISFQL 566 +++ N + A+ C+ +NNY +W I I I +S QL Sbjct: 1480 IIYQLNYENAVKLCQSFNNYQDWVILIQKIKEPRLSKQL 1518 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 476,080,580 Number of Sequences: 1657284 Number of extensions: 8057564 Number of successful extensions: 17627 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 17023 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17620 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 41902926763 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -