BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0020 (598 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_1221 - 27130321-27130491,27130616-27130664,27131120-271311... 28 4.9 >12_02_1221 - 27130321-27130491,27130616-27130664,27131120-27131188, 27131845-27131939,27132032-27132121,27132885-27132968, 27133122-27133211,27133310-27133624,27134184-27134399, 27134736-27134774,27135337-27135408 Length = 429 Score = 28.3 bits (60), Expect = 4.9 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 479 CCFHIVIKHYYHFCNSI**FGEKQHCLIVYRL 384 CCFH K YY + + FG +QHC Y + Sbjct: 375 CCFHGRRKQYY-LGSKVTCFGSEQHCAPKYSI 405 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,543,394 Number of Sequences: 37544 Number of extensions: 180630 Number of successful extensions: 272 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 271 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 272 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1423789920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -