Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0020
         (598 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g50780.1 68418.m06291 ATP-binding region, ATPase-like domain-...    27   7.2  

>At5g50780.1 68418.m06291 ATP-binding region, ATPase-like
           domain-containing protein low similarity to microrchidia
           [Homo sapiens] GI:5410257; contains Pfam profile
           PF02518: ATPase, histidine kinase-, DNA gyrase B-, and
           HSP90-like domain protein
          Length = 823

 Score = 27.5 bits (58), Expect = 7.2
 Identities = 13/44 (29%), Positives = 24/44 (54%), Gaps = 1/44 (2%)
 Frame = +3

Query: 462 YNVKTALTECKKYNNYHEWFIYIL*IHTKHISFQL-LGYVSXSQ 590
           Y  K A   C KY+N +   I++L +H   +S  + +G+V  ++
Sbjct: 445 YRPKEAADGCAKYSNLYNLKIWLLVLHVSQLSAVVTIGFVKDAK 488


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,283,590
Number of Sequences: 28952
Number of extensions: 170643
Number of successful extensions: 248
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 245
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 248
length of database: 12,070,560
effective HSP length: 77
effective length of database: 9,841,256
effective search space used: 1190791976
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)