BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0017 (698 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0469 - 4127950-4127988,4127989-4128264,4128845-4130861,413... 30 2.0 02_01_0750 + 5574707-5576017 29 3.5 05_01_0475 - 3818121-3820565 28 6.2 >08_01_0469 - 4127950-4127988,4127989-4128264,4128845-4130861, 4131134-4131987 Length = 1061 Score = 29.9 bits (64), Expect = 2.0 Identities = 19/102 (18%), Positives = 41/102 (40%), Gaps = 1/102 (0%) Frame = +1 Query: 337 QEKVCSTTKDVFWDRSKIRLLLKLCLEDRFKNINKQKTLWHDIASHVGTT-GXXXXXXXX 513 Q+K C D WD+ RL+ + ++ T +++A+ VG Sbjct: 282 QKKRCFVVIDDIWDKDSWRLIRCALQDSNHESRVVTTTRIYEVATQVGEVYKMHPLSHDE 341 Query: 514 XXXXTYIRLLKKNRLGKEIKWVHYNTCEEVFKECKSLPSSFL 639 Y R++ G+ ++ C+++ K+C +P + + Sbjct: 342 SKKLLYTRIISGE--GESLRSTSVEACDKILKKCGGVPLAII 381 >02_01_0750 + 5574707-5576017 Length = 436 Score = 29.1 bits (62), Expect = 3.5 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = -3 Query: 354 TTNFFLWLAIMFLYDYRRFIYVDKLSIFSCFYYDLVS 244 T FF++ + +FL +RFIY+D L C Y D+ S Sbjct: 302 TKPFFMYKSKLFLGSQKRFIYIDILDGTVC-YVDIPS 337 >05_01_0475 - 3818121-3820565 Length = 814 Score = 28.3 bits (60), Expect = 6.2 Identities = 13/38 (34%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = +2 Query: 122 LKMDMNNPPNQSYWFVLREDQSNVILS-TNNFVNQNPQ 232 + + +NPPN YW E S+ ++S N +N NP+ Sbjct: 209 IDLSRSNPPNM-YWSWSSEKSSSALISLLNQLININPE 245 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,369,203 Number of Sequences: 37544 Number of extensions: 302349 Number of successful extensions: 624 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 611 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 624 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1792053856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -