BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0016 (598 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81463-4|CAB03852.2| 3118|Caenorhabditis elegans Hypothetical pr... 29 1.9 Z82276-6|CAJ15166.1| 305|Caenorhabditis elegans Hypothetical pr... 28 5.8 >Z81463-4|CAB03852.2| 3118|Caenorhabditis elegans Hypothetical protein C06B8.7 protein. Length = 3118 Score = 29.5 bits (63), Expect = 1.9 Identities = 14/35 (40%), Positives = 22/35 (62%), Gaps = 5/35 (14%) Frame = +1 Query: 310 VPTQKTYNYVEKNKY-----DNIVVLDHSFALGMF 399 VP+ YNY+EKN++ D + + S+ALG+F Sbjct: 1642 VPSYVQYNYIEKNRFINQRGDYVDMWPRSYALGVF 1676 >Z82276-6|CAJ15166.1| 305|Caenorhabditis elegans Hypothetical protein K03D3.12 protein. Length = 305 Score = 27.9 bits (59), Expect = 5.8 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = +1 Query: 454 ITKMVVMFYYNVKTALTELRSXTINHEWFIYIL 552 I K + +F+ + LT R+ +N+ WF+YI+ Sbjct: 122 IEKWLSIFFPKFEPYLTSARNMLLNNIWFLYIV 154 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,720,381 Number of Sequences: 27780 Number of extensions: 184381 Number of successful extensions: 401 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 397 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 401 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1268802960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -