BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0016 (598 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase pro... 25 0.75 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 22 5.3 DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 21 6.9 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 21 6.9 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 21 6.9 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 21 6.9 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 21 6.9 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 21 6.9 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 21 6.9 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 21 6.9 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 21 6.9 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 21 6.9 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 21 6.9 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 21 6.9 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 21 6.9 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 21 6.9 S78459-1|AAB34403.1| 50|Apis mellifera mast cell-degranulating... 21 9.2 >AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase protein. Length = 588 Score = 24.6 bits (51), Expect = 0.75 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +1 Query: 331 NYVEKNKYDNIVVLDHSFA 387 NY E+NK D IV+L +++ Sbjct: 284 NYAEENKRDEIVLLTEAYS 302 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 21.8 bits (44), Expect = 5.3 Identities = 11/35 (31%), Positives = 16/35 (45%) Frame = +2 Query: 227 NSYRHLKKKCLHYSQCYNSME*HSQLNKYRRKRHI 331 N+ KC S Y++ + HSQL R H+ Sbjct: 356 NTLERTPSKCSQTSVHYSNGQTHSQLCPTPRSTHL 390 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 6.9 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +2 Query: 236 RHLKKKCLHYSQCYNSME*HSQLNKYRRK 322 R KKK Y Q +N E H + RR+ Sbjct: 10 REYKKKDRRYDQLHNVEEKHLRERTSRRR 38 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 6.9 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +2 Query: 236 RHLKKKCLHYSQCYNSME*HSQLNKYRRK 322 R KKK Y Q +N E H + RR+ Sbjct: 10 REYKKKDRRYDQLHNVEEKHLRERTSRRR 38 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 6.9 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +2 Query: 236 RHLKKKCLHYSQCYNSME*HSQLNKYRRK 322 R KKK Y Q +N E H + RR+ Sbjct: 10 REYKKKDRRYDQLHNVEEKHLRERTSRRR 38 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 6.9 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +2 Query: 236 RHLKKKCLHYSQCYNSME*HSQLNKYRRK 322 R KKK Y Q +N E H + RR+ Sbjct: 10 REYKKKDRRYDQLHNVEEKHLRERTSRRR 38 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 6.9 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +2 Query: 236 RHLKKKCLHYSQCYNSME*HSQLNKYRRK 322 R KKK Y Q +N E H + RR+ Sbjct: 10 REYKKKDRRYDQLHNVEEKHLRERTSRRR 38 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 6.9 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +2 Query: 236 RHLKKKCLHYSQCYNSME*HSQLNKYRRK 322 R KKK Y Q +N E H + RR+ Sbjct: 10 REYKKKDRRYDQLHNVEEKHLRERTSRRR 38 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 6.9 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +2 Query: 236 RHLKKKCLHYSQCYNSME*HSQLNKYRRK 322 R KKK Y Q +N E H + RR+ Sbjct: 10 REYKKKDRRYDQLHNVEEKHLRERTSRRR 38 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 6.9 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +2 Query: 236 RHLKKKCLHYSQCYNSME*HSQLNKYRRK 322 R KKK Y Q +N E H + RR+ Sbjct: 259 REYKKKDRRYDQLHNVEEKHLRERTSRRR 287 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 6.9 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +2 Query: 236 RHLKKKCLHYSQCYNSME*HSQLNKYRRK 322 R KKK Y Q +N E H + RR+ Sbjct: 259 REYKKKDRRYDQLHNVEEKHLRERTSRRR 287 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 6.9 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +2 Query: 236 RHLKKKCLHYSQCYNSME*HSQLNKYRRK 322 R KKK Y Q +N E H + RR+ Sbjct: 259 REYKKKDRRYDQLHNVEEKHLRERTSRRR 287 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 6.9 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +2 Query: 236 RHLKKKCLHYSQCYNSME*HSQLNKYRRK 322 R KKK Y Q +N E H + RR+ Sbjct: 259 REYKKKDRRYDQLHNVEEKHLRERTSRRR 287 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 6.9 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +2 Query: 236 RHLKKKCLHYSQCYNSME*HSQLNKYRRK 322 R KKK Y Q +N E H + RR+ Sbjct: 259 REYKKKDRRYDQLHNVEEKHLRERTSRRR 287 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 6.9 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +2 Query: 236 RHLKKKCLHYSQCYNSME*HSQLNKYRRK 322 R KKK Y Q +N E H + RR+ Sbjct: 259 REYKKKDRRYDQLHNVEEKHLRERTSRRR 287 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 21.4 bits (43), Expect = 6.9 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +2 Query: 236 RHLKKKCLHYSQCYNSME*HSQLNKYRRK 322 R KKK Y Q +N E H + RR+ Sbjct: 259 REYKKKDRRYDQLHNVEEKHLRERTSRRR 287 >S78459-1|AAB34403.1| 50|Apis mellifera mast cell-degranulating peptide protein. Length = 50 Score = 21.0 bits (42), Expect = 9.2 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = -3 Query: 161 FFIAVILVIQYF 126 FF++VIL+ YF Sbjct: 10 FFLSVILITSYF 21 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 138,202 Number of Sequences: 438 Number of extensions: 2508 Number of successful extensions: 20 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17482179 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -